KEGG   Methanothrix thermoacetophila: Mthe_1341Help
Entry
Mthe_1341         CDS       T00417                                 

Definition
(GenBank) carbon-monoxide dehydrogenase, catalytic subunit
  KO
K00198  anaerobic carbon-monoxide dehydrogenase catalytic subunit [EC:1.2.7.4]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00633  Nitrotoluene degradation
mtp00680  Methane metabolism
mtp00720  Carbon fixation pathways in prokaryotes
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1341
   00680 Methane metabolism
    Mthe_1341
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mthe_1341
Enzymes [BR:mtp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     Mthe_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane
Motif
Other DBs
NCBI-ProteinID: ABK15116
UniProt: A0B8U2
Position
complement(1444813..1446684)
Genome map
AA seq 623 aa AA seqDB search
MANKTATESIDPATTKMLLEARRAGLETVWDRFNKQQPQCGFGQLGICCRNCNMGPCRID
PFGDGPDKGVCGATADIIVARNLLRMIAAGAAAHADHARDAVIVFKEALEGRARSYQIRD
EAKLRELAAEYNISSWGEQGGAADLANALLSDFGRQEGYVTLTRRAPEKRRKIWESLGIS
PRGIDREIVECMHRTHMGVDNDPLHILQHGLRTSIADGWGSSMIATEVQDILFGTPSPRR
SEANLGVLKEDEVNIIVHGHEPILSEMIVEAASDPEMIKLAKSVGANGINVAGICCTGNE
VLMRHGIPVAGNFLQQELAVITGAVEAMVVDVQCIMPSLGGLAACYHTKFISTSPKAEFP
GALRMEFSEERAAEIAREIVRTAVENYPKRDRGRVLIPRERSECMVGFSVEAILKALGGT
PQPLIDAIVNGSIKGIAAVVGCNNPKVPHDHGHVNLVRELIRNNVLVVTTGCNAIACAKA
GLLRPAAAKEAGDGLRGVCESLGVPPVLHMGSCVDISRILVVAAAIANKLGVDISDLPVA
GAAPEWMSEKAVSIGAYVVASGVFTVLGTVPPVLGSPVVTRILTKDLGDAVGATFAVEPD
PFKASKLIIEHIESKRRALGLKV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaaaactgcaacggaaagcatcgatccggccaccacgaagatgctgctcgag
gcacgcagggctgggctggagactgtttgggatcgtttcaataaacagcaaccgcagtgt
ggattcggacagctcggcatttgctgccgcaactgcaacatgggtccatgcagaatagat
ccctttggggatggacctgataagggcgtatgtggcgcgacagctgacatcattgttgcg
cgcaacctcctgaggatgatagctgcaggcgcagcagcacatgctgaccatgcaagggat
gcagtcatagtgttcaaagaggcattagagggaagggcaaggagttatcagatcagggat
gaggcgaagctcagagagcttgcagccgagtacaacatctcgagctggggggagcaggga
ggtgcagcggatctagcaaacgcccttctctcagacttcggaaggcaggagggatatgtg
acgctcacccgcagagccccggagaagcgccggaagatctgggagagtctggggataagc
ccgagaggcatcgacagggagatcgtggagtgcatgcaccgcacccatatgggtgtggac
aacgacccgcttcacatcctgcagcatgggctgagaaccagcatcgccgacggctggggc
tcgtcgatgattgcgacagaggtgcaggatattctctttggaacgccatctcccaggaga
tcagaggcgaacctgggagtgctgaaggaggatgaagttaacataatcgtccacggccac
gagcccatcctctcggagatgattgttgaagctgcatcagatccggagatgatcaagctc
gcaaagagtgtcggagctaacggaatcaacgtcgctgggatatgctgcaccggaaatgag
gtgctgatgcgccatggaattccagttgcaggaaacttcctccagcaggagctcgctgta
atcacgggcgctgttgaggcgatggtggttgatgtgcagtgcatcatgccgtcgctaggc
ggcctcgccgcgtgctatcacacgaagttcatctcgacctctccaaaggcagagttcccc
ggggcgctcaggatggagttcagcgaggagagggcagcagagatcgcaagggagatcgtg
agaaccgcggtcgagaactacccgaagcgggacaggggcagagttctcataccgagggag
aggagcgagtgcatggttgggttcagcgtcgaggccatcctgaaggcgctcggcggaaca
ccgcagccgctgatagatgcgatagtaaacggatccataaagggcatcgcggcggtcgtc
gggtgcaacaacccaaaggttccgcacgaccatggtcacgtcaacctcgtcagggagctg
atcaggaacaacgtgctcgtagtaaccacaggatgcaacgcgatcgcctgcgcaaaagca
ggtctgctcaggcctgcggctgcaaaggaggccggagacggtctcagaggtgtctgcgag
tccctcggcgtcccgccggttttgcacatgggctcatgcgttgacataagcagaattctt
gtagtggcagcagcgatcgcaaacaagcttggcgtggacataagcgatcttccagtggca
ggcgcggctccagagtggatgagcgagaaggcggttagcatcggggcatatgttgttgca
tccggagtgtttacagtgctgggcacggttccgcctgttctcggaagccctgtggttacg
agaatcctgacgaaggacctcggcgatgctgttggggcgacgtttgcagtagagccggat
ccgttcaaggcatccaaactcattatagaacacattgagagcaagagaagggcgctgggt
ctgaaggtgtga

DBGET integrated database retrieval system