KEGG   Methanothrix thermoacetophila: Mthe_1369Help
Entry
Mthe_1369         CDS       T00417                                 

Definition
(GenBank) LSU ribosomal protein L15E
  KO
K02877  large subunit ribosomal protein L15e
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp03010  Ribosome
Module
mtp_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Mthe_1369
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtp03011]
    Mthe_1369
Ribosome [BR:mtp03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    Mthe_1369
  Archaea
    Mthe_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L15e
Motif
Other DBs
NCBI-ProteinID: ABK15144
UniProt: A0B8X0
Position
complement(1463578..1464189)
Genome map
AA seq 203 aa AA seqDB search
MNQAEVNGLRSFYGYIKDAWNSPAKSYVGRLRAQRMIAWRREMSVQRIERPTRLDRARAL
GYKAKQGIVLARVRVRRGALRKSRYVRNRRTKHMAMHRQNPGKSLQRIAEERASRRFRNM
EVLNSYWVGQDGRHKWFEVILVDPNHPAIKSDRDLSWICGGSHRGRAERGKTSAGKKGRG
LRRKGFGTEKTRPSIRAHDGRGK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccaggctgaggtgaacggattgaggtctttctacggatacataaaagatgcctgg
aactctcccgcgaagagctatgttggaaggctcagagcgcagaggatgatagcctggcgg
cgtgagatgagcgttcagaggatcgagcggccgacgaggctcgacagggccagggcgctt
ggatacaaggcgaagcaaggcatagtgctggccagggtgagggtgagaagaggcgccctc
cggaagtccaggtacgtcaggaacagaaggacgaagcacatggccatgcacaggcagaac
ccgggaaagagcctccagcggatcgcggaggagagggcatccaggcgcttcagaaacatg
gaggtccttaactcgtactgggttgggcaggacggcagacacaagtggtttgaggtgata
cttgtagacccgaaccacccggcaattaagagcgacagagatctcagctggatctgcggc
ggctctcacagaggcagggccgagaggggcaagaccagcgcaggcaagaagggacgcggt
ctccgcaggaagggcttcgggacagagaagacccgccccagcataagggctcatgacggt
aggggtaagtga

DBGET integrated database retrieval system