KEGG   Methanothrix thermoacetophila: Mthe_1371Help
Entry
Mthe_1371         CDS       T00417                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2114
Motif
Other DBs
NCBI-ProteinID: ABK15146
UniProt: A0B8X2
Position
complement(1464938..1466452)
Genome map
AA seq 504 aa AA seqDB search
MNISRRLFKPKPRIAESPPVKLLELRSKPYYIVASVEVGNTTTKSILTATDMDTGKTQIV
NKTVRMTRDVRPPKPGEEIFGRTICGTPLTKESIAELVRDTLLESHQAAGLLIERDLNFV
VRSTGVVAEFDSPEEVGIFIQALAQGCLDAGVPPRLMTPAMSIYNIPERFRRYSLIEKIV
FNGPVASVWPPMGATGVEIVANEMEGELATAGIKQGAKWTDVDFRNPCLAMDFGTTLDGR
ITSEEIPYARTIGNFCGVAGAIPDAVVRGTGLVDATTGTALDIFKDKNSGVNKKARLYAE
EIDLLIKIERVPVGTKRYGYVPLDAAAAQKLGVVLIGCDCGENGSKLNELSEIGGEIYRR
DGLKVLSATLDLVSAKIARRLVEVAIEEGLVTKRTAIGVTGRAGISGNKPELILEEIGKL
GLYDEPEKNIVFVDDGLARGAAVMARCMNSMGTPKNPMGGIRGGRCILKERIEYEKNKLP
TAGIPQADKRSMVSDYVAEGHLRR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatatctcccgtcgtctcttcaagccaaaaccaaggatagctgaaagcccgccggtc
aagctgctggagctcaggagcaagccgtactacatagtcgcatccgtggaggtgggaaat
acaacgacaaaatcgatactcacagccactgatatggacacaggcaagacgcagatagtc
aacaagaccgtccgcatgaccagggatgttaggcctccgaagcctggcgaggagatattc
ggcaggaccatatgtggcacgccactcacaaaggaatcgatcgccgagcttgtcagggat
actctgcttgagagccatcaggcagcaggcctgctgattgaacgggatctgaacttcgtg
gtgaggtccacaggtgtcgtcgccgagttcgactcacccgaggaggtcggcatattcatc
caggcgctggcgcagggctgtctcgatgccggcgtgcctccaagactgatgacacctgcg
atgtccatctacaacatccctgagaggttccgcaggtactcactcatagagaagatcgtc
tttaacgggcctgtggcgtctgtctggccaccgatgggcgcgactggagtggagatcgtg
gcaaacgagatggagggcgagcttgcaacagctggtataaagcagggtgcaaagtggact
gatgttgatttcaggaacccgtgtcttgcaatggacttcggcacgaccctggatgggagg
ataacgagcgaggagatcccctatgcgaggacgataggaaacttctgtggtgtagcaggc
gccatacctgatgcggtggtcaggggtaccggtcttgtggatgcaacaacgggaacagca
cttgacatctttaaagataagaactcaggtgtgaacaagaaggcgaggctctacgccgag
gagatagatctcctgataaagatagagcgcgtgccggtcggaacgaagcggtacggctat
gttccccttgatgccgcagcagcgcagaagctgggggtcgtgctgataggctgcgactgt
ggtgagaatggctcgaagctcaacgagctctcggagatcggtggagagatatacaggagg
gatggtctgaaggtgctctccgccacgctcgatcttgtgagcgcgaagatcgccaggagg
ctcgttgaggtcgcgatcgaggaggggcttgtcacaaaaagaacagcgataggcgtcacg
ggaagagctgggatatcggggaacaagccggagctcatcctcgaggagatcggcaagctg
ggattgtatgatgagcctgagaagaatatcgtttttgtggacgatggactcgcgcgcggc
gctgctgtcatggcgagatgcatgaactcgatgggtacgccaaagaacccgatgggaggg
atcagggggggcaggtgcatactcaaagagcggatcgagtatgagaagaacaagctcccg
acagcaggcataccgcaggctgataagagaagtatggtaagcgattatgtcgcagagggc
cacctgagaagatga

DBGET integrated database retrieval system