KEGG   Methanothrix thermoacetophila: Mthe_1376Help
Entry
Mthe_1376         CDS       T00417                                 

Definition
(GenBank) Tetratricopeptide TPR_2 repeat protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_1 TPR_2 TPR_7 TPR_10 SNAP TPR_8 TPR_16 TPR_14 TPR_11 RPN7 TPR_19 DUF3856 TPR_9 TPR_4 TPR_3 Foie-gras_1 CorA Het-C ANAPC5
Motif
Other DBs
NCBI-ProteinID: ABK15151
UniProt: A0B8X7
Position
complement(1470297..1474082)
Genome map
AA seq 1261 aa AA seqDB search
MRTIAGFLDGVIKDDRVIERIALETHGTISSLARAVLASNRAGALSHLDEIAEQNSASRD
HSLWFSLGMISQQLGSLERAVSHLSRALERASGADAVKVLSRLGSIYANVEDLDRAISLY
RDALSRLESGDPERAGILINLSMAYREARRWDDALQCSSDAIYLLRSSGDRSSVARAIME
EAEIRREMGDLSSAEELYRTCLEEFERLGEIPFVCRSLEMLGRISQLRGESRRAEDLFDM
AMHRYEHCHEIEGASRTALLLGDLHAIEGRFSSAEECYLKALEGFREVSDRESVANTLLS
LARLYGSMGEWRGAVERYREALDILQSEQSQDLARALREMGTACYRLRDYEMAQNYFMKS
LELSEALGERDGMAASHTGMGHMLSDLGDWDGAVEHYERGAELLREMGDLRGAAACTSNI
ASVYQMMGDLEKALDIYHDALQIQERLGDMQGASKTLNNMGLVYQHMGEIEAAERNYMRC
LELKEQLGDVHGAANTHINLATLYEIQRRWDDAITHYQDALETFEAIGDRRGMAAVMNNL
GNVYEEKGDILQAIKSYRMSMELDGGDASIAKISWNLGGLYQRIGDAESAEKCYRASLEA
FQSIGDERGAAYALMGLGSIALERGLWDDALDCFKRCVDLRLDTPEALRVLGSIASVYER
KGMWQEALAEYRKVLERFRGMGDSLGVAAVLSTIGNLLAEQGHWDDALEHYSESLEIFER
LGDGYSTAVTTNNMANVLYRRGEWDRALNLYSKAMEHFQRVGDMHSYGATLSNIASIHYR
RGEWERAIELYHKSLEIFEGLEDSGASAMVLNNLGLLYHRRGEWSLAVDHFRLAAECAMR
AGDHEAATEFRANIDMVRSCRGEASVDIDGYLKKLEEIERAGDVEMAAEMHGILANAYAD
IFRWEEALDHYQKSLELFERTGDRYSAAETMFNMALIYRDRGEWSIAEDLLSRSMSEFRA
LKASPCYSMSRLNLGLLKEIRGADPEEDILSAITTFESIGAIPDLCEAYLAMARVKLNRG
EMSEARFYLSEAETLILKTGYDSMKIRLYIEWGDFYLSQAPFEARSSYQKALALARKMGL
TRDEGVALRSLGAASLNAGDYDEAEEHLQKALTLFKSINSMYDLLSTYALMATLYFNRKD
HSRAEETALLLERQARRLGYRDLQVKALEVIAGCELATSRTDAAVSTYLEALNIAQSDGV
SKRLLTELTRNIVSSLQDILRERANLSDLSAIKTVECLLEALRAGLTYRVDFADDIVLGG
A
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaccatcgcaggtttcctggatggtgttattaaagatgacagggtgatcgagagg
atcgcgctggagacccacgggaccatatcatcgctggcaagagctgtgctcgcctcgaat
cgcgccggggcgttatcacatctagatgagatcgcggagcagaattcagcatccagagat
catagcctctggttttcgctgggcatgatctcgcagcagctcggttcgctcgaacgggcg
gtgagccatctttcaagggctttggagcgtgcatcaggagcagatgcggttaaggttctt
tcaagacttgggtcaatttatgcaaatgtggaggacttggatcgggcgatctctctctac
agagatgcgctctcgcgactggaaagcggggatcctgagcgcgctggtatcctcataaac
ctctccatggcatacagagaggcaagacggtgggatgatgcactgcagtgcagctctgat
gcgatatatctcctcagatcatcaggagacagaagctccgtcgcgagggcgatcatggag
gaggccgagatccggagggagatgggggatttatcatctgctgaggagctctacaggacg
tgccttgaggagttcgagcggctgggggagattccgttcgtgtgcaggtctctggagatg
ctgggtcgcatatctcagctcagaggcgaatccaggagagctgaggaccttttcgatatg
gccatgcacaggtacgagcactgccatgagatagagggagcatcgaggactgcacttctt
ctgggagatctgcatgcgatcgaggggaggttttccagcgcggaggagtgctacctgaag
gcgctggagggctttcgagaggtatcagatcgcgagagcgtggcgaacacactgctgagc
ctcgccaggctctacgggtccatgggcgagtggaggggagctgtcgagcgctatcgcgag
gctcttgatatcctgcagtctgagcagtcacaggatctcgcaagggctctaagagagatg
gggactgcatgctacagattgagagattatgagatggcgcagaattatttcatgaagtct
ctcgagctcagcgaggccctcggggagagggacggcatggctgcatcgcacacaggcatg
ggtcacatgctctcagaccttggcgattgggatggcgctgtagagcactatgagaggggt
gccgagctcctgcgtgagatgggagatctcaggggtgctgcagcatgcacatcaaacata
gcgagcgtgtaccagatgatgggggatctggagaaggcgctggatatctatcacgatgct
cttcagatccaggagcggcttggcgatatgcagggcgcgtcgaagacactgaacaacatg
gggctcgtctaccagcacatgggcgagatcgaggctgctgagagaaactacatgcgctgc
ctggagctgaaggagcagctcggggatgtccacggcgccgcgaacacccacatcaacctc
gcgaccctttacgagatccagaggcgctgggatgatgccataacccattatcaggatgct
ctggagacgttcgaggcgatcggcgatcgcaggggcatggctgcggttatgaacaacctc
gggaacgtgtacgaggagaagggggatattctgcaggcgataaagagctacaggatgagc
atggagctcgatggtggagatgcaagcatcgcgaagatatcatggaatcttggggggctc
taccagaggatcggggatgctgagagcgcggagaagtgctacagggccagcctggaagcc
ttccagagcattggagatgagaggggtgcggcctatgctctcatgggcctcggcagcatc
gcgctggagcgtggcctttgggacgatgcgctggactgttttaagaggtgtgtcgatctc
aggcttgatacgccagaggccctgagggtgcttggaagcatcgcatctgtttatgagaga
aagggcatgtggcaggaggctcttgcagagtacaggaaggtgcttgagaggttcaggggg
atgggagattctctcggtgttgcagcggttctgagcacaatcggcaacctcctggcggag
caggggcactgggatgatgcccttgagcactacagtgagagccttgagatattcgagagg
ctcggcgacggctacagcacagcggtcaccacaaacaacatggcaaatgtgctttacagg
aggggtgagtgggaccgagctttgaacctgtactcgaaggcgatggagcacttccagcgg
gtcggggacatgcatagttatggagcaacgctgagcaacattgcgagcatacactacagg
agaggggagtgggagagggcgatagagctctaccacaagagcctcgagatcttcgagggg
cttgaggattcgggggcatccgcgatggttctgaacaacctcgggctcctgtaccacagg
aggggcgagtggtcgcttgcagtcgatcacttcaggctggcagcagagtgcgcgatgcgt
gcaggcgatcacgaggcagccacggagttccgggcgaacatagatatggtgagatcatgc
cgcggagaggcatctgtagatatcgatgggtatctcaaaaagcttgaggagatcgagagg
gcaggtgatgttgagatggctgcggagatgcacgggatactggcaaatgcatatgctgac
atcttccgctgggaggaggcgctggatcattaccagaagagcctggagctcttcgagcgc
accggcgacaggtacagcgctgcggagacgatgttcaacatggctctgatctacagggat
cggggtgagtggtcgatcgccgaggacctcctctcgaggagcatgagcgagttcagagcg
ctgaaggcatcgccatgctacagcatgtcgcgtctcaacttggggcttttgaaggagatc
aggggagctgatcctgaggaggatatactatccgcgatcaccacgtttgagagcataggc
gcgatcccggatctctgcgaggcatatctcgcgatggccagggtgaagctgaacagaggg
gagatgagcgaggcgcgcttctacctctccgaggcggagacgctcatactgaagaccggt
tatgattccatgaagatcagactttacatcgagtggggtgacttttacctgtcgcaggcc
cccttcgaggccaggagcagctaccagaaggctcttgctcttgctagaaagatggggctc
acgagggatgagggtgtggcgcttcgcagtctcggtgcggcatctctgaacgccggcgat
tacgatgaagcagaggagcacctccagaaggccctgacgctcttcaaatcgatcaactcc
atgtacgatctcctctctacgtatgcgctcatggcgaccctgtacttcaacaggaaggat
cactccagggcagaggagactgccctcctcttagagcgacaggccagaaggctcggctat
agggacctgcaggtcaaggcgctggaggttatcgccggctgcgagctggcgacttcgaga
acagacgcagctgtgagcacataccttgaggcgctgaacatagcgcagtcagatggtgtc
tctaagagactgctaacagagctgaccaggaacatagtcagcagcctccaggatatcctc
agggagagggcgaacctctcagatctctccgcaataaaaacagtcgagtgcctgctcgag
gcgctccgcgccggtctgacgtacagggtggatttcgcagacgatatcgtgctcggaggc
gcatag

DBGET integrated database retrieval system