KEGG   Methanothrix thermoacetophila: Mthe_1377Help
Entry
Mthe_1377         CDS       T00417                                 

Definition
(GenBank) protein of unknown function UPF0153
  KO
K06940  uncharacterized protein
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mthe_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CxxCxxCC
Motif
Other DBs
NCBI-ProteinID: ABK15152
UniProt: A0B8X8
Position
complement(1474340..1474972)
Genome map
AA seq 210 aa AA seqDB search
MPKVYISLSFDRVRFKCQRCGACCHHRRPSEFPDLIPPELVQRFVERSNLIHLNEDEVTR
ISRVYGLRPDEFVDTLYPYNGRTVRVSDDGLKVVLDIPVLKSKPDTTCVFYDNGCRIYPH
RPRACRLFPFRISEREIAGDVVLSIDYNPGCPGIGKGDYADTRKIRELAVEIFSRRMNAI
TRETKELIASGSIKPDMVVYRTMPGGPRTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaagtttatatctctctatcatttgacagggttcgcttcaaatgtcagcgctgc
ggcgcgtgctgccaccaccgcaggccatcagagtttccggatttgataccgccggagctt
gtgcagaggttcgtcgagcgctcgaacctcatacatctgaatgaggatgaggtcaccaga
atatcgagagtttatggtctcaggccggatgagtttgtcgatactctgtatccctacaac
gggaggaccgtcagggtctcggatgacggtctgaaggttgtgctggatatacctgtactt
aaatccaagccggatacgacctgcgtcttttacgacaatggctgcaggatatacccgcac
aggcccagggcgtgcaggctctttccctttcgcatatctgagcgtgagatcgcgggggat
gtggttctcagcatagattacaatccaggctgccccggtatcggaaagggggattatgct
gatacgagaaaaatacgggagctggcggtggagatcttctcaagacgcatgaacgctatc
acccgcgagacaaaggagctcatcgcatcgggatccatcaagcctgatatggtggtgtac
agaaccatgcccggtggaccccgaaccaggtga

DBGET integrated database retrieval system