KEGG   Methanosaeta thermophila: Mthe_1378Help
Entry
Mthe_1378         CDS       T00417                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Module
mtp_M00357  Methanogenesis, acetate => methane
mtp_M00567  Methanogenesis, CO2 => methane
mtp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mthe_1378
Enzymes [BR:mtp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mthe_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: ABK15153
UniProt: A0B8X9
Position
complement(1475019..1475954)
Genome map
AA seq 311 aa AA seqDB search
MFRFDRKQEVFDFGKFKIGGQPGEYPTCCIGTMFYARHKIVSDPEHGVFDKNAAEKLWNQ
QVEMSEITGNTCMNQIVAETNEAMQKEIDWFVEISDYPFLIDSSAPEVRAFGVKYATEIG
VADRAIHNSINASITDEELQALKESDLDAAIVLAFNAMEKGTKGKMDILTKAAGGAKKGM
LEYAKDCGITRILIDTAAMPLGAGSGATYRACIAVKAMLGLPVGGGFHNAASAWDWMKKW
KKTHKEAFAPVDIGSNLVAGIVGADFYLYGPIENAPMIFPAAAMVDIMKAESIQELGLEV
LDPNHPIKKTL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggttcgatagaaagcaggaggtcttcgacttcggcaagttcaagatcggaggc
cagcctggcgagtacccaacttgctgcatcggcactatgttctatgccaggcacaagata
gtatccgatccggagcatggagtattcgataagaacgctgctgagaaactctggaaccag
caggttgagatgagtgagatcacagggaacacctgcatgaaccagatcgtggcagagacg
aacgaggctatgcagaaggagatcgactggttcgtggagatctccgactaccccttcctc
atcgattcctctgctccagaggtgcgtgccttcggagtcaaatacgccacagagatcggt
gtagcggacagggcgatacacaactcaatcaacgcctcaataacagatgaggagctgcag
gcgctgaaggagagcgatctggatgccgcgatagtcctggcgttcaacgccatggagaag
ggcactaagggcaagatggacatactcacaaaggcggcgggcggcgccaagaaggggatg
ctcgagtacgcgaaggactgcggcataacgaggattctcatagacacagcggcgatgccg
ctgggagctggctcaggagcgacatacagagcatgcatcgctgtcaaggcgatgctgggc
ctgccggtcggcggaggcttccacaacgctgcgtccgcatgggactggatgaagaagtgg
aagaagactcacaaggaggcgttcgcacctgttgatatcggctcgaacctcgtggccgga
atcgtgggtgctgacttctacctatatggtccgatcgagaacgctccgatgatcttcccg
gctgcggcgatggtcgacatcatgaaggctgagtcgatccaggagctcggcctcgaggtg
ctggatccgaaccatccaataaagaagaccctgtag

DBGET integrated database retrieval system