KEGG   Methanothrix thermoacetophila: Mthe_1384Help
Entry
Mthe_1384         CDS       T00417                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00680  Methane metabolism
mtp01100  Metabolic pathways
mtp01120  Microbial metabolism in diverse environments
mtp01200  Carbon metabolism
Module
mtp_M00357  Methanogenesis, acetate => methane
mtp_M00567  Methanogenesis, CO2 => methane
mtp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mthe_1384
Enzymes [BR:mtp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mthe_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD EcsB
Motif
Other DBs
NCBI-ProteinID: ABK15159
UniProt: A0B8Y5
Position
complement(1478368..1479057)
Genome map
AA seq 229 aa AA seqDB search
MNFDALTIVYILEIIVGGLLVGVGVHFVPVGGAPAAMAQATGVGTGTVQLAAGSGLTGLL
AAGLMMSVTDNIWPILASGAVGAMIMIDATMMVGGWIYAYAVGAPFASAKVNYDPITGYS
QPPYVAPGTVGQGIPTVSFVSGTIGGFMGGLGGALIYYPLMMINHNPSLSALFAIGIFLV
NAVLASWNIQGTIEGFHDPKFKRWTKAFRSCLVATLILALVAVTITGGA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgacgcgttgaccatagtgtacattcttgagatcatcgtgggcggcctgctt
gtgggcgtgggtgttcacttcgtgccggtcggcggcgcgcctgcggcaatggcccaggct
acaggagttggcacgggcacagttcagcttgctgctggatccggcctcactggcctgctg
gccgcaggtctcatgatgtcagtcacagataacatctggccaattctggcatcaggagcc
gttggagcaatgataatgatagatgccacaatgatggttggtggctggatatacgcttac
gcagtgggcgcaccattcgcatcagccaaggtcaattacgatccgatcaccggatactct
cagccaccgtatgttgcccccggcacagtcgggcagggtatacccacagtctcctttgtg
agcgggacgatcggcggcttcatgggcggtctcggcggtgctctgatctactacccgctg
atgatgataaatcataacccatctctgagtgccctcttcgcgatcggcatattcctggtg
aacgccgttctggcttcctggaacatccagggaacgatcgaggggttccacgatccgaag
ttcaagagatggacaaaggcgttcagatcatgtctggttgccaccctgattctggcactg
gtggccgtgacaataacgggaggtgcatga

DBGET integrated database retrieval system