KEGG   Methanothrix thermoacetophila: Mthe_1389Help
Entry
Mthe_1389         CDS       T00417                                 

Definition
(GenBank) transcriptional regulator, XRE family
  KO
K07731  putative transcriptional regulator
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mtp03000]
    Mthe_1389
Transcription factors [BR:mtp03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Mthe_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 MqsA_antitoxin HTH_26 HTH_25
Motif
Other DBs
NCBI-ProteinID: ABK15164
UniProt: A0B8Z0
Position
1484099..1484818
Genome map
AA seq 239 aa AA seqDB search
MNSEGEFSNIRGLLAEKIAGEITLSQNPGETLRKWRRNFGISQTELSNYLGISPSVISDY
ESGRRRSPGILIVSKIIDALLKIDELRGCNVLRAYESMFGDMVGLSAICSVCEYARPVTL
AEFMAEIDATLICGSTDVQINGYTIIDSIKAILELLPEQFYKIYGRSTARALIFTGVTRG
RSPLVAIRVSNLKPGAVILQGIEAERVDPVAVKIARVENIPLLTTLLSPEELSSSLSRI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgagggtgagttttcaaacatcaggggcttgctggccgagaagatcgccggc
gagatcacgctttcccagaaccctggcgagaccctcagaaagtggcgccggaacttcggg
ataagccagacagagctctcgaactacctgggcatatcaccgagcgtgataagcgattac
gagagcggaagaagacgatcaccaggcatactgatcgtcagcaaaatcatcgatgcgctt
ctcaaaatagatgagctgagaggatgcaatgtgctgcgcgcatacgagagcatgtttggg
gatatggttggtctcagcgcgatctgctccgtatgcgagtatgccaggccggtcacgctt
gcggagttcatggccgagatcgatgcgacacttatatgcgggagcacggatgtgcagatc
aacggctacacgataatcgatagcataaaggcgatactggagcttctgcctgagcagttc
tataagatatatggtcgaagcactgccagagcacttatattcacaggtgtcacaaggggt
agatcgccgctggttgcaataagggtttcaaacctgaagccaggggcggtcatcctccag
ggcatagaggctgagcgcgtggatccggtggctgtaaagatagcaagggtggagaacata
ccccttcttaccacgctgctctcgccagaggagctttccagcagcttgagcaggatatga

DBGET integrated database retrieval system