KEGG   Methanothrix thermoacetophila: Mthe_1391Help
Entry
Mthe_1391         CDS       T00417                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00071  Fatty acid degradation
mtp00072  Synthesis and degradation of ketone bodies
mtp00280  Valine, leucine and isoleucine degradation
mtp00380  Tryptophan metabolism
mtp00620  Pyruvate metabolism
mtp00630  Glyoxylate and dicarboxylate metabolism
mtp00640  Propanoate metabolism
mtp00650  Butanoate metabolism
mtp00720  Carbon fixation pathways in prokaryotes
mtp00900  Terpenoid backbone biosynthesis
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01200  Carbon metabolism
mtp01212  Fatty acid metabolism
mtp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mthe_1391
   00630 Glyoxylate and dicarboxylate metabolism
    Mthe_1391
   00640 Propanoate metabolism
    Mthe_1391
   00650 Butanoate metabolism
    Mthe_1391
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1391
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mthe_1391
   00072 Synthesis and degradation of ketone bodies
    Mthe_1391
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mthe_1391
   00310 Lysine degradation
    Mthe_1391
   00380 Tryptophan metabolism
    Mthe_1391
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mthe_1391
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mthe_1391
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mthe_1391
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtp04147]
    Mthe_1391
Enzymes [BR:mtp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mthe_1391
Exosome [BR:mtp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mthe_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABK15166
UniProt: A0B8Z2
Position
1485864..1487027
Genome map
AA seq 387 aa AA seqDB search
MRSVSIIGIGCTRFGERWGSSLRDLVVETGIAAIEDAGVTGEAIDALYIGNMSGGRFVEQ
EHIGALIADYAGLSRLHIPSTRVEAACASGGLALREAFLAVASGYADIVIAAGVEKMTDV
SSGVAADALAAAADREWECFFGATFPALYAMIARLHMRRYGTTREQLAQVAVKNHHHGHM
NPIAQYHTEIKVDDVINSPLVADPLRILDCSPITDGAAAVVLAPTDIASRYSDTPIRILA
SAQASDSLALHDRRDITTLDATVYAAKKAFAQARLTPADIDIAEVHDCFTIGEILAIEDL
GFFPKGEGGIATEEGRTSIGGDVAVNTSGGLKACGHPVGATGIKQAYEIVLQLRGEAGKR
QVSDAEIGLTHNVGGSGGTALVHILSR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggtctccataatagggatcggatgcacgcggtttggcgagcggtggggcagc
tccctgcgcgatctggtcgtggaaacgggaatcgctgcgatagaggatgctggcgttaca
ggcgaggcaatagacgcgctctacatcggaaacatgagcggtggcagatttgtggagcag
gagcacataggcgctctgattgcagactacgcaggtctctcaaggctgcacataccatcg
acaagagtggaggctgcatgtgcgtccggtggccttgcgctccgtgaggcgttcctggca
gtcgccagcggctacgcagacatagttatagcagccggcgttgagaagatgaccgatgtc
tcaagtggtgtcgcggcggatgcccttgctgcagctgctgacagagaatgggagtgcttc
tttggcgcgacatttcctgcgctctatgcgatgatcgcgaggcttcacatgcgaaggtat
ggcacgacaagagagcagctcgcgcaggtggctgtgaagaaccatcaccatggacatatg
aatccgatagctcagtaccatacagagataaaagtggacgatgtcatcaactccccgctg
gtcgcagatcctctcagaatactggactgctcgccgataaccgatggagcggctgcggtt
gttctggcacccacagatatcgcatcaaggtactctgacacacccatcaggatccttgcg
agcgcgcaggcgagcgacagcctcgcgcttcatgatcgtagagacataacgacgctggat
gcgacggtctatgcggcgaagaaggcgttcgctcaggcgcggttaactccagctgatata
gacatagcagaggttcatgactgcttcaccataggagagatactcgccattgaggacctc
gggttcttccccaagggagagggggggattgcgacagaggaggggaggacttcaatagga
ggcgatgtcgcagtcaacacctctggggggctgaaggcgtgtggccatccggtgggcgcc
acgggcataaagcaggcgtatgagatcgtgctccagctgaggggcgaggcgggcaaacgt
caggtgagtgacgctgagatcggtctgactcacaacgttggcggctccggaggaactgca
ctggtgcacatactctcgaggtga

DBGET integrated database retrieval system