KEGG   Methanothrix thermoacetophila: Mthe_1394Help
Entry
Mthe_1394         CDS       T00417                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.99.1.3]
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtp03032]
    Mthe_1394
   03400 DNA repair and recombination proteins [BR:mtp03400]
    Mthe_1394
Enzymes [BR:mtp01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     Mthe_1394
DNA replication proteins [BR:mtp03032]
 Prokaryotic Type
  DNA Topoisomerases
   Mthe_1394
DNA repair and recombination proteins [BR:mtp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Mthe_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: ABK15169
UniProt: A0B8Z5
Position
1489476..1491866
Genome map
AA seq 796 aa AA seqDB search
MAEIDVDVTEEMKSSYIDYAMSVIVGRALPDVRDGLKPVHRRILYAMYEQGVTFDQPYKK
SARIVGDVMGKYHPHGDVAIYDTMVRMAQDFSMRYTLIDGQGNFGSVDGDPPAAMRYTEV
RLSKIAGEMLADIEKDTVDFVPNYDGSLKEPTVLPSRLPNLLVNGSTGIAVGMATNIPPH
NLREVVYALIHLIENPDASVTDLMNFIRGPDFPTGGYIVGRSGIESAYSTGRGTITIRAR
SEIEEGRRGSRIIFTELPYQVNKAKVVEDIAELVKAGRVDGISEIRDESDREGIRLVVEL
KQGVNPQVVLNQLHKHTQLETTYGIINLVLVDGQPRTLTLKETLEQYINYRAEVIERRTR
FELEQAEKRAHILAGILIALRDIDEVIALIRGSPSPSDARNLLMNRFGLSEEQARAILDM
RLQRLTGLEQEKVASEARELESTIARLKGILASRTEVLDIIKNELRELDEIYGDDRRTEI
LESVESVRPEDLIQDEEVAVIITNNGYIKRQPLSVYRMQRRGGKGSIGAETKSEDFVTDI
FTASTLDYLMIFTDRGKAHWLRVYEIPMVSKVARGRPIASLLQLEENERITEAIPVESFG
TDEYIVLATRNGSIVKTPLRAFSNPRRGGIKAVNLRGDSLVAARLTDGSRELIVATKKGK
AIRFHESDVRSSGRGSMGVKAINLSEGDELISMDVVKEGETLFTITTQGYGKRTELSEYP
LQRRGGKGVKNIDTRRGDVVAAITVSDDDGLLITTKEGVMIRIAASDVRVQGRATQGVKI
MDVKPGDEISDVARVD
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcagagatagatgtcgatgtaacagaggagatgaaatcctcctacatagattacgcg
atgagcgtgatcgtcgggcgggctcttcccgatgtcagggatggcctgaagccggtccac
aggcgcatcctctacgccatgtacgagcagggcgtgacattcgatcagccgtacaagaag
tccgcccgcatcgtcggtgacgtgatgggtaaatatcacccgcatggcgatgtggcgatc
tacgacaccatggtcaggatggcacaggacttctcgatgcgctacacccttatagatggg
caggggaacttcggctcggtcgatggagatccgccagctgcgatgcgttacacagaggtt
cggctctcgaagatcgcgggcgagatgctcgcagatatcgagaaggatactgtggatttt
gtcccgaactacgacggttccctcaaagaaccgaccgtgctcccgtccaggctcccgaac
cttctcgtcaacggatccacaggcatagctgtcggaatggcgacgaacatcccgccccac
aacctccgggaggtcgtgtacgcgctcattcacctgatcgagaaccctgatgcatctgta
acggatctcatgaacttcataaggggcccggatttccccaccggaggatacatagtgggg
agaagcggtatagagagcgcgtattccacaggcagaggtacgataacgatcagagccaga
tccgagatagaggaggggcgaaggggctcgaggataatattcacagagctcccctatcag
gtcaacaaggcgaaggtcgttgaggatatcgcagagctggtcaaggccggaagggtggat
gggatctcagagatcagggatgaatctgacagagaaggaataaggctggtcgtggagctg
aagcagggcgtgaatcctcaggtggtcctgaaccagctccacaagcacacacagctcgag
accacctacgggataataaacctcgtcctcgtcgatggacagcccagaaccctgacgctg
aaggagacgctggagcaatacatcaactacagggctgaagtgatcgagaggaggacccgc
ttcgagctcgaacaggcggagaaaagagctcatatcctcgcgggaattctgatcgccctc
agagatatagatgaagtcatagccctgataaggggctcgccctcgccctccgatgccaga
aatctgctcatgaataggtttggtctcagtgaggagcaggcaagggcgattctggatatg
aggttgcagcgtttgactggcctggagcaggagaaggtcgcatccgaagcaagagaactc
gagtccacgatcgcaagattgaaggggatactcgcgagcaggacggaggtcctcgatata
attaaaaatgaactgagggagctcgacgagatctacggcgatgatagaaggacggagata
ctggagtccgtggagtcggtcagacccgaggacctcatccaggatgaggaggtcgccgta
ataataacaaacaacggctacatcaaacgtcagccactctctgtgtacagaatgcagaga
agagggggaaaggggagcattggggccgagacgaagagtgaggatttcgtcacggatata
ttcacggcatcaacgcttgattacctcatgatcttcacagacaggggcaaggcccactgg
ctgagggtctatgagataccgatggtctccaaggtagccagaggcagaccgatagccagt
ctcctccagcttgaggagaatgagaggataaccgaggcgattcctgtcgagagcttcggc
acagatgaatacatcgtgctcgcaacacgtaacggaagcattgtgaagactccgctgagg
gcgttcagcaacccgaggaggggcgggatcaaggcagtcaacctccgcggcgactctctt
gtggctgccaggctcacagacggctcgcgtgagctgatagtcgccacaaagaagggcaag
gcgataaggttccacgagagtgatgtgaggtcgagcggaaggggatctatgggtgtgaag
gcgataaatctctcagagggggatgagctgatctccatggacgttgtgaaagagggcgag
acactcttcaccattacaacccagggatacggtaagaggacggagctgagcgagtatccg
ctccagaggcgcggcggcaaaggggtcaagaacatagacacacggagaggggacgtggtg
gccgcaatcacagtgtcagacgacgacggactcctgataaccacaaaagaaggggttatg
ataaggatagctgcatcagatgtgagagtgcagggaagggcaacacagggcgtgaagatc
atggacgtaaagcccggagatgagatttcggatgtggcgagggtcgattag

DBGET integrated database retrieval system