KEGG   Methanothrix thermoacetophila: Mthe_1395Help
Entry
Mthe_1395         CDS       T00417                                 

Definition
(GenBank) transposase, IS605 OrfB family
  KO
K07496  putative transposase
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Mthe_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OrfB_Zn_ribbon OrfB_IS605 HypA zinc_ribbon_2 IBR Ntox28 C1_2 TF_Zn_Ribbon ESM4
Motif
Other DBs
NCBI-ProteinID: ABK15170
UniProt: A0B8Z6
Position
1492254..1492955
Genome map
AA seq 233 aa AA seqDB search
MSHCLRSEVCEVGCLKSFVVDTGNNSVENPGFAEKVSTKVKNIHRRLSRAEKGSKNRQTL
IDKLNKVNYKIKNQRNDFLHKLSRHYVNNYKIICVEDLDVKRMKENGHNKSMHRDIHDAF
WSRFMFMLSYEAECAGRRLIEVNPMNTTQRCSACRSIVEKELSDRVHECPHCGFSCDIDC
NASMHIAGMEQPVAPMESTSTSHFCDASVGYDVGSPALQGGAVHTTYEAYPVW
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagccattgcctgagatcggaggtgtgtgaggttggatgtctgaaatcatttgttgtg
gacacaggtaacaactctgtggagaatccagggtttgcagagaaggttagcactaaagtt
aagaacatccataggagattatccagagctgagaaaggctccaagaatcgtcagacactc
atagataagctgaacaaggtaaattataaaatcaagaatcagagaaacgattttctccac
aagctctcaagacactatgtcaacaactataagataatctgtgttgaagatctggatgtc
aaacgtatgaaggagaatggccataacaaaagcatgcatcgtgacatccatgatgcattc
tggtccaggttcatgttcatgctctcgtacgaggctgaatgtgctggtcgaaggctgatc
gaggtgaatcccatgaacaccactcaaaggtgttctgcctgtagaagcattgtagaaaaa
gagttatcggacagggttcatgagtgtcctcactgtggattctcatgtgatatagactgc
aatgcttccatgcacatcgcagggatggaacagcccgtagcgcccatggagtcaacttct
acatcacatttctgtgatgcaagtgttggctatgatgtgggaagccctgcccttcagggt
ggggcagttcatacaacgtatgaggcataccctgtgtggtag

DBGET integrated database retrieval system