KEGG   Methanothrix thermoacetophila: Mthe_1396Help
Entry
Mthe_1396         CDS       T00417                                 

Definition
(GenBank) protein of unknown function DUF125, transmembrane
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VIT1 IncD
Motif
Other DBs
NCBI-ProteinID: ABK15171
UniProt: A0B8Z7
Position
1492959..1493552
Genome map
AA seq 197 aa AA seqDB search
MVIPRIELYRRYLKASGALEIARRLFVMNAFDGVLTIMGVVLGAYLSGVQDSGFVITAGM
GGSIAMGISGMSGAYMAERAERMRDIKKLESAMLRDLNGTHVVRAFRTASVVVALVDGIS
PAIAALLLILPFFMVPMISIGVAAMLSLALGLVVLFFLGLFLARISEEVALISGLKMMLV
GVLTILIVSLAVSPDAL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcccgcgcatagaactctacagaaggtacctcaaggccagcggcgcgctggag
attgccaggcgtctcttcgttatgaacgcatttgatggcgttctgacgatcatgggtgtg
gttcttggggcatatctatcaggtgtccaggattctggatttgtgataaccgcaggaatg
ggcggaagcatagcgatgggcatatcgggaatgagcggagcttacatggcggagagggct
gaaaggatgagggatatcaagaagctggaatctgcgatgctcagagatctcaatggcact
catgttgtcagggcatttagaactgcgagcgttgtggttgcgctcgtcgacggaatcagc
ccggcgatcgcagcccttctcctgatcttgccgttcttcatggtcccgatgataagcata
ggcgttgcggccatgctctcgcttgctctcgggctggtggtgctcttcttcctcgggctc
ttcctggccaggataagcgaggaggtggcactgataagcggtctgaagatgatgcttgtc
ggcgttctgaccatactgatcgtgagccttgcggtctctccggatgcgctgtga

DBGET integrated database retrieval system