KEGG   Methanothrix thermoacetophila: Mthe_1397Help
Entry
Mthe_1397         CDS       T00417                                 

Definition
(GenBank) replicative DNA polymerase I
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00230  Purine metabolism
mtp00240  Pyrimidine metabolism
mtp01100  Metabolic pathways
mtp03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mthe_1397
   00240 Pyrimidine metabolism
    Mthe_1397
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mthe_1397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtp03032]
    Mthe_1397
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Mthe_1397
DNA replication proteins [BR:mtp03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     Mthe_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_exo2 RNase_H_2 DNA_pol_B_2 CPSase_L_D3
Motif
Other DBs
NCBI-ProteinID: ABK15172
UniProt: A0B8Z8
Position
1493787..1496612
Genome map
AA seq 941 aa AA seqDB search
MHFQILDANYVYDMSGYPVVQLFGIRDNGDSIICRVSGFRPYFYASAHDITSAAEAVESM
DLDVEIVERYEPIGYQSKPIKMLRIIAKDPKSVREIRDRVREIPSVRAVYETDILFKNRF
LIDTGLGGMAWVKVLDVERDSTSAKESRDGLSWYGLANYREVERDSTSAKESRVLEGCEM
RERRRFIVDVPVEKLAPEDLESTAPLRFMSFDIECLPQNGEMPRPESSPVILISMAFHPP
YHGMSDLVLVGRELECDRPDVEGCADERALISRFVSVIDDYDPDIIAGYNSNEFDIPYLR
ERASRLGIEMNVGRDGSTWLIRSMGSNKNVAVTGRVVVDLLPIIRSSFSLKQYTLRNAAM
ELIGEEKRDMDPARMESIWLGGDGLADLIRYSRRDAVLVMQLLLRLRLMDKYIALARVSG
SLLQDIVNGGQSGMVENLILRRFRSHKRVLPPKPDSEESGERFTDADELKGGAVLPPVKG
LVENVVILDYKSLYPTIMMAHNLCYSTVVTKERPPEVVKSPSGGYFASPSVCKGIVPEIL
RELLEKRTETKMLMKSAGEDERAFLDAKQYALKILLNSFYGYSGYARARLYSLTLANAVT
SFGRHNILRTKEMIEEIGSVYIVDGKALLPEETSVSSNPKPPDTIELNSAGRRYDLSVVY
GDTDSVFVRISSGYSITPEDAELIGRKIAETITSKLPKPMELVFEAFARRAIFLAKKRYA
LWLFERVSTQSKPLDGVEGSSKTPSEGSGIIWRDRIKVRGMETVRRDWCDLTSKTLRRCL
ELILKEGRVDDAVQHVRDVIQRLRDMDIRRDRELLDDLVLTRRFTKDPSSYRNKQPHIQL
VEKMRRRGGRVPGVGDRVPFIIVKGGKKTLFVDRAEDPEYAVENNLPIDTEYYIEKQLLP
PVLRLFMPFDVDRESLLQCRSQKNLLHFDQKAQRQRTLLDF
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgcactttcagatcctggatgcaaattacgtctacgacatgagcggctatcctgtggta
cagctgtttggcatcagagataatggggatagcatcatctgtcgcgtctcgggattcagg
ccgtatttttacgcaagcgctcatgatatcaccagtgcagcggaagctgtcgaatccatg
gacctcgatgtggagatcgtcgagcgatacgagcccatcgggtaccagtcgaagccaata
aagatgctgaggataatcgcgaaggacccgaagtctgtcagggagataagggacagggtg
agagagattccctctgtgagggcagtctacgagaccgacatcctgttcaagaacaggttt
ctcattgatacaggtctcggcggcatggcgtgggttaaagtcctggatgttgagagagat
tcgacctcagcgaaggagtcgagggatggcctttcgtggtatgggctcgcaaattacaga
gaggttgagagagattcgacctcagcgaaggagtcgagggtgctcgaaggatgcgagatg
cgcgaaaggcgccggtttatcgttgatgtgcctgtggagaagctggcgccggaggatctg
gagagcactgcgcccctcaggttcatgtccttcgatatcgaatgtctcccacagaatggg
gagatgccgaggccggagagctcccctgtgatactgataagtatggcgtttcatccccct
taccacgggatgagcgatctcgttctcgtggggagagaactcgaatgtgataggccggat
gttgaggggtgtgcagacgagagagcccttatctccagatttgtgtccgtgatcgatgat
tacgatcccgacataatcgcgggctacaactcgaacgagttcgacattccatatctaaga
gagcgtgcatccaggctcggcatcgagatgaatgtgggtcgtgacggaagcacgtggctc
atcaggagcatgggcagcaacaaaaacgtcgctgtgacaggccgggttgttgttgacctg
cttccgatcatcaggtcctcattcagcctgaagcagtacactctgagaaatgctgccatg
gagctgatcggggaggagaagcgagatatggaccctgccaggatggaatcgatctggctt
gggggagatgggctggccgatctaatacgctactcgaggcgggatgctgtgcttgtgatg
cagctcctcctccgcctgaggctgatggataaatacatagcgctggcgagggtgagcgga
tcgctgctccaggacatagtcaacggcggccagagcggcatggtggaaaatctcattctc
agaaggttccgatcgcataagagagtcctcccgccgaagccagactcggaggagtcgggt
gagcggttcacggatgcagatgagcttaagggtggtgcggtgctccccccggtgaagggc
cttgtggagaatgtggtcatcttggactacaaatcgctctaccccacgataatgatggcc
cacaacctctgctactcaacggtggtcacaaaggaaagacctccagaggttgttaaatcg
ccatccggcgggtatttcgcatctccctctgtctgcaaggggatcgtgccggagatactg
agggagctgctggagaagaggacggagacgaagatgctcatgaagagcgcaggagaggac
gagcgcgcatttctcgatgcaaagcagtacgcgctcaagatcctgctgaacagcttctac
gggtactccggatacgcaagggcgaggctgtacagtctgactctggcgaacgctgtcaca
agcttcgggagacacaacatactgaggacaaaggagatgatcgaggagatcggctcagtc
tacattgttgacgggaaagctctgcttcccgaggagacttccgtctcctccaatccgaaa
ccccccgacacaattgaacttaattccgccggaagacgctacgacctctctgttgtctac
ggtgatacagacagcgtcttcgtgaggatatcatcaggttacagcatcacccccgaggat
gcggagctgataggaagaaagatcgctgagacgatcacatcgaagctccctaagccgatg
gagctcgtattcgaggcgtttgccaggcgcgcgatattcctggcgaagaaaaggtatgcc
ctttggctcttcgaaagagtttcgacgcagtcgaaacctctcgacggagtcgagggatct
tcgaagaccccatccgaaggaagtgggatcatatggagggacaggataaaggtcaggggc
atggagaccgtgcggcgggactggtgcgacctcacatcaaagaccctgaggagatgcctg
gagctgattctgaaggaaggcagggtggatgatgcagttcagcacgtgagggacgtgatc
cagcggctaagggatatggacatcaggcgggacagagagctccttgatgatcttgtgctc
acaaggcgattcacaaaggatccatcctcatacaggaacaagcagccacacatccagcta
gtcgagaagatgagaaggcgcggcggaagggtccccggggtgggagaccgggtcccgttc
ataatagtcaagggaggcaaaaagacgctcttcgtcgacagggctgaggatccggagtat
gcggtggagaacaaccttccaatagatacagaatactatattgagaagcagcttcttccg
cctgtcctcaggctcttcatgccgtttgatgtggacagagagagccttctccagtgcaga
tctcagaagaaccttctccatttcgatcagaaggctcagaggcagcgaaccctgctggat
ttctag

DBGET integrated database retrieval system