KEGG   Methanothrix thermoacetophila: Mthe_1398Help
Entry
Mthe_1398         CDS       T00417                                 

Definition
(GenBank) elongation factor Tu, domain 2 protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU_D2 GTP_EFTU_D4 3-dmu-9_3-mt
Motif
Other DBs
NCBI-ProteinID: ABK15173
UniProt: A0B8Z9
Position
1496779..1497729
Genome map
AA seq 316 aa AA seqDB search
MPNLNVAVLGKAEFSKDLGKRGTASDITFYNLKRGGTTVTFVEPTRYPERLAPLFYVLSM
ARSAILIVEKIDQLFGEAVLALDCMGIRDGYIVLKNYITEEEIAPLVRSTAVERYTVIDD
NPIEIRESLLEDADAVVHEEDVSGTLPVDHFFNVRGVGTVVLGNVAEGTIRKHDLLRVLP
GDKNAQIRSIQKHDEDFESASAGERAGLALKGIEVSELDRGTVLTTNDAVKTSTSLRSRA
EIVRYWQSPLREGMVLHLGHWMQYLPARIESSSGDPRSPDLNLSLDRPLVHLPGDRALMT
YPEGGKLRIVGTISLP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacctcaatgtggcggtgctcggtaaagcagagttctcgaaggatctgggcaag
aggggcacagccagcgatataacgttttacaacctcaagagaggtgggacgaccgtgacc
ttcgtcgagcccaccaggtatccggagcgactggcgccgctcttctacgttctgtccatg
gctcgcagcgccatcctcatcgtggagaagatagaccagctcttcggggaggcggttctc
gccctggactgcatgggcattcgcgatggttacatcgttctgaaaaactacataacagag
gaggagatcgcgcctcttgtcagatcaactgctgtcgagagatatactgtgatcgatgac
aatcccatagagatacgcgagagtcttcttgaagatgcagatgctgtggtacacgaggaa
gatgtctcaggaacgctccccgtggatcatttcttcaatgttcggggcgtcgggactgtc
gtcctgggaaatgttgcagaggggactatcagaaagcacgatcttctcagggttctgcct
ggcgataagaatgctcagatacgctccatccagaagcacgacgaggatttcgagagcgcg
agcgcgggggagcgcgcgggtcttgcgctgaagggcatagaggtctctgagctagatcgt
ggaactgttctaaccacgaatgatgctgtaaaaacctccaccagtctcagatcgagagca
gagatcgtgaggtactggcagtcaccgctgagggaagggatggtacttcatctgggacac
tggatgcagtatctccctgcgagaatcgaatcttcctcaggcgatccgcgaagccctgat
ctcaatctctcgctggacaggcctctcgtccatctcccgggagacagggcgctcatgaca
tacccagagggaggaaagctgaggatagtcgggacgatctcgttaccgtga

DBGET integrated database retrieval system