KEGG   Methanosaeta thermophila: Mthe_1399Help
Entry
Mthe_1399         CDS       T00417                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00500  Starch and sucrose metabolism
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mthe_1399
Enzymes [BR:mtp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Mthe_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ABK15174
UniProt: A0B900
Position
complement(1497864..1500017)
Genome map
AA seq 717 aa AA seqDB search
MIDRFPDIPARIEGLRELACNLWWSWHHPARDLFNMLNPAAWQLSVHNPVKLLHEIDRSV
LERAAENDHFLRHYDAVISRFRSEMRGKGGWFPSHIRNPMNVPIAYFSAEYGLHHSMPFY
AGGLGFLAGDYLKECSDLRLPVIGVGFMYPGGYLRQRLSPDGWQLSESEILDKSHAPISQ
VLDENGKPLLVRVPVIEPPIYVGVWKLRIGRIPLYLLDTDIEANDPWNRGISSRLYIGDA
EQRLRQEIVLGIGGMSVLESMGINNLVLHLNEGHPAFAVLERLRYLIGNGMSCREAIDYV
RRTTVFTTHTPVPAGHDIFPFHLMEKYFNSYLPTIGLTRDQFFRLGIDPANPQVGFNMTA
FAMRMSLYRNCVSRRHLEVTESMWRHLLSELKSNGTVIDHVTNGVHVLTWLDRSMEDLFN
RYLGLGWLEEHDDPSIWALVDDIPDRELWMAHRMAKMRLITTIRERARLRWSMDGADPRI
IVASGVLFDPSVFTIGFARRFATYKRATLILQDLNRLRSILNNEDMPVQIIFAGKAHPAD
DTAKQIIQKVYNVAKDPSFGGRIAFVEDYDEQLAQYMVHGVDLWLNTPQPPLEASGTSGM
KAMVNGVPQLSILDGWWLEGYNGRNGWAFEGAEGADRDVRDAHSLYELLENDIVPLFYRV
ENNDGVPHGWVRVMKEAIKSTAPRFSSRRMVKEYTNKFYVNALDAANSFSMSMTQES
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatagacagatttccagacataccggcgaggattgaagggctgagggagctggcgtgc
aacctctggtggtcgtggcaccatcctgccagagatttattcaacatgctcaatcctgcc
gcatggcagctcagcgttcataaccccgtgaagctgctccacgagatagacagatctgtg
ctggagagggcagctgagaacgatcatttcctgagacactacgacgcggtcatctccagg
ttcaggtccgagatgaggggaaaaggtgggtggttcccatcacacatcaggaacccgatg
aatgtgccaattgcatacttttcagcagagtatggcctccatcactcgatgccgttctac
gccggcggcctgggattcctggcgggtgattacctcaaggagtgcagcgatctcaggctt
ccggttatcggtgtgggcttcatgtatcccggcgggtatctcaggcagagattatctcca
gatggctggcagcttagcgagagcgagatcctggacaagagtcacgcgccgatatctcag
gtgctcgacgaaaacggcaaaccgcttctcgtaagggttcctgtgatagagccgccgata
tatgtgggtgtgtggaagctcaggataggcaggatcccactgtatcttctggatacagac
atcgaggcaaacgacccctggaaccgggggatatcatcacgcctttacattggagatgct
gagcagaggctgaggcaggagatagtgctgggcatagggggtatgagcgtactcgagagc
atgggaataaataatctggtgctgcatctcaatgagggccacccggcattcgcggtcctg
gagagactcaggtacctcataggaaatggcatgagctgcagggaagccatcgattatgtc
aggagaacgaccgtgttcaccacacacaccccagttccagcgggccatgatatattccca
ttccatctcatggagaagtacttcaactcatatctgcccacgattggactaactcgcgat
cagttcttcaggctgggcatagatccagcgaacccacaggttgggttcaacatgaccgca
ttcgcgatgcggatgtcactgtacaggaactgtgtcagcaggaggcatctcgaggtcacc
gagtcgatgtggcgtcacctgttatcagagctcaaatcgaatggtactgtcatcgaccac
gtcaccaacggggtacacgtactcacgtggctcgatcgcagcatggaggatctgttcaac
aggtatctagggcttggatggctggaggagcacgacgacccctcgatatgggcgcttgtg
gacgacatacctgacagagagctctggatggcacaccgaatggcaaaaatgagattgata
acaacgataagagagcgcgccaggctcaggtggtccatggacggcgcagatcccaggata
atagtcgcgtctggtgtgctttttgatccatctgtcttcacaataggcttcgcgcggagg
ttcgctacatacaaaagagccacgctgatactccaggatctgaaccgcctcaggagcatt
ctcaacaacgaggacatgccggtccagataatattcgcaggcaaggcgcatcctgcagac
gatacggccaagcagataattcagaaggtctacaacgtggcaaaggatccgagctttggg
ggaaggatcgcgttcgtagaggattatgatgagcagctcgcccagtatatggtccatggt
gttgacctgtggctgaacacgccgcagccgccgctcgaggcatccggcaccagcgggatg
aaggcgatggtcaatggcgtgccacagctcagcatccttgacggctggtggctagagggg
tacaacggcagaaacggctgggcattcgagggcgccgagggagcggatcgggatgtgagg
gacgcacacagcctctacgagcttctggagaacgacatcgtgcctctcttctacagagtg
gagaacaacgatggagtgccgcatggctgggtaagggtaatgaaggaggcgataaagagc
accgcaccgaggttctcctcgaggaggatggtgaaggagtatacaaacaaattctacgtg
aatgccctggatgcggccaacagcttcagcatgagcatgacccaggagagctga

DBGET integrated database retrieval system