KEGG   Methanothrix thermoacetophila: Mthe_1402Help
Entry
Mthe_1402         CDS       T00417                                 

Definition
(GenBank) TfuA domain protein, core
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TfuA
Motif
Other DBs
NCBI-ProteinID: ABK15177
UniProt: A0B903
Position
1502775..1503401
Genome map
AA seq 208 aa AA seqDB search
MPHDEARSILDADYRPPARRGDVLAAARDGADLICLIDGVFFQDSSVAHKEILEALRMGV
RVIGASSMGALRAAEMDVYGMEGVGEIYRAYRSGEIVADDEVALVFDPVTLAPLSEPLVN
IRHNLRLAVSEGWIDKQTAADLLDIARSRYFPSRSYENLMKDAAGRVPEEKLLQFRRFLE
SRRADLKREDAIRALRRAAEVARELQLQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatgatgaggcgcgctccatactcgatgcagattatcggccgccagcaaggcgc
ggcgacgttctcgccgctgcaagagatggcgcggacctgatatgcctgatagatggcgtc
ttcttccaggactcatccgtggcgcacaaggagatcctcgaggcgctgcggatgggtgtg
agggtcatcggcgcctccagcatgggtgctctgagggcagctgagatggatgtctacggg
atggagggcgtcggcgagatctacagggcatacaggagcggggagatagtcgctgatgat
gaggtcgctctggtcttcgatcccgtcacgctagcgcccctttcagagccgctcgtcaac
atacgccacaacctcaggcttgccgtgagtgaaggatggatcgataagcagaccgctgcg
gatctgctggatattgctagatccaggtacttcccgtccaggagctacgagaatctgatg
aaggatgcagccggcagggtccctgaggagaagcttctccagttcaggagatttcttgag
agcagacgagcggatctcaagagggaggacgccataagggcgctcaggagggctgcggag
gttgccagggagctgcagctccagtga

DBGET integrated database retrieval system