KEGG   Methanothrix thermoacetophila: Mthe_1406Help
Entry
Mthe_1406         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABK15181
UniProt: A0B907
Position
1508052..1508579
Genome map
AA seq 175 aa AA seqDB search
MLKVRGAIRARAEEFLKVLAEVEQSLSRCSDETTRLARALALLELAYLPLRPEMCPFCVE
YADERCSECGYAETHGGICNSDSSRFVQLSDAIMNLGAAVKFSDPDGIAEENIQSSISSA
RMATDALLSELGRLDASGLMRAKALYIKEILRALPVRGALDQLRQICISRAELYW
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaaggtgaggggcgcgatcagggcgagggcagaggagttcctgaaggttctggcg
gaggtcgagcagagcctgtcgagatgctctgatgagacaaccaggctggccagggcgctc
gcgctactggagctcgcctacctccccctcaggccggagatgtgtcccttctgcgtggag
tacgcagatgagcgatgctcagagtgtggttatgcagaaacgcacggaggcatatgcaac
agtgatagctcaagatttgtgcagctctcagatgccatcatgaatctgggggctgcagtg
aagttctcagatccagatggtatcgcggaggagaacatacagagttccatcagctcagct
cgaatggcgacagatgctcttctctcagagctgggcaggctcgatgcatccgggctgatg
cgcgcaaaagccctgtacataaaagagatcttgcgcgcgctgccagtgcggggagcgctc
gatcagctcaggcagatctgcataagtagagctgagctgtactggtga

DBGET integrated database retrieval system