KEGG   Methanothrix thermoacetophila: Mthe_1409Help
Entry
Mthe_1409         CDS       T00417                                 

Definition
(GenBank) phosphotransferase KptA/Tpt1
  KO
K07559  putative RNA 2'-phosphotransferase [EC:2.7.1.-]
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtp03016]
    Mthe_1409
Enzymes [BR:mtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     Mthe_1409
Transfer RNA biogenesis [BR:mtp03016]
 Prokaryotic Type
  tRNA spricing factors
   Other tRNA splicing factors
    Mthe_1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_2-RNA
Motif
Other DBs
NCBI-ProteinID: ABK15184
UniProt: A0B910
Position
complement(1511307..1511954)
Genome map
AA seq 215 aa AA seqDB search
MDSEQAIRRCPQHGFFRGNVCSCGSRGKLVLDGVRTEKLGRLLAGALRHFPDDLGLAMSP
QGWVEIPVLVDAIRTRYRWANENLVMALVRSDPKGRYEINGTRIRARYGHSVGVDLDYPE
NELPTLYYGTAEEEAERLLEVGLKSATQRYVHLSTTPDKAWEVGTFRTSNPKIIVVDAAG
AQREGVRMMKVNESMVISDPIPPRFLSMMPAKAQR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggattcagagcaggcgataaggagatgcccgcagcatggatttttcagagggaatgta
tgcagctgcgggagcagggggaagctggttctcgatggtgtgaggaccgagaagctcggg
agactgcttgcaggagcgttgcgacacttccctgacgacctcgggctggcgatgagcccg
caggggtgggtggagataccggtgcttgtggatgccatccggaccagatatagatgggca
aacgagaatctcgtaatggcgctcgtaagatcagatccaaaggggaggtatgagataaac
ggcacgcgaataagggccagatacggccattctgtcggtgtggatctcgactacccggag
aacgagctgccaacactctactacgggaccgcagaggaggaggcagagcggctgctggag
gtcggcctgaagtcagccacacagaggtatgtacacctcagcaccactccggataaggca
tgggaggtcggcacattcaggacgagcaacccgaagataatcgtggttgacgcggcagga
gctcagcgtgaaggggtgagaatgatgaaggtgaacgagagcatggtcatctccgatccg
atacccccgagatttctgagcatgatgccggctaaggctcagaggtag

DBGET integrated database retrieval system