KEGG   Methanothrix thermoacetophila: Mthe_1411Help
Entry
Mthe_1411         CDS       T00417                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K07137  uncharacterized protein
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mthe_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 FAD_binding_2 GIDA HI0933_like DAO FAD_binding_3 NAD_binding_8 FAD_oxidored Pyr_redox Pyr_redox_3 Lycopene_cycl Thi4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABK15186
UniProt: A0B912
Position
1513083..1514447
Genome map
AA seq 454 aa AA seqDB search
MQDVVVVGAGPAGLFAALELSVHGKSVVVVDKGRDISERNCPMKKWGHCLHCEPCHIMCG
MGGAGTYSDGILNLHPAIGGDLTRLTDDPWALVDEVDSVFLRYGAPLETQEPTQNDVEEL
SRRAASVGARFIPIKQRHMGSDRTPEIIREFSNDLKRRGVRFVLNSSAADLIIEKDVCMG
VRLSDGGEIRAESTLLAPGRIGAEWIGEVIERYGIKARYGPLDVGVRVEVPSIVMDPVTR
INRDPKFHIITHRYDDFIRTFCTNPGGFVVKEEYRDFIATNGHSMSGERSENTNFAFLVR
LELTKPIENTTAYGISIAKLVTTIGGRRPVIQRLGDLHRGRRSTGERIARNPVRNTLKDV
TPGDISMALPHRIVMDVIEGLEILNEIIPGVNADSTLLYAPEIKFYAREISVDKDLQTSI
QSLYAAGDGAGLSRGIVAAAATGLLAARGILRGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgtagtcgtggtcggtgccgggcctgcaggactcttcgcggctcttgagcta
tccgtccacgggaagagcgtggtggttgtcgacaagggcagggacatctctgagaggaac
tgccccatgaagaagtgggggcactgtcttcactgcgaaccctgtcatataatgtgcggg
atgggcggcgctggcacatactcagatggcatactcaatctccatccggcaataggcgga
gatctcacgcgccttacggatgatccatgggctcttgtggatgaggtggactcggtattt
ctgagatatggcgccccccttgagactcaggagcccacgcagaatgatgtggaggagctg
agccggagggctgcatcagtcggtgcgagatttataccgataaagcagcgccacatggga
tccgataggacgcctgagataataagggaatttagcaatgacctcaaaaggcgtggtgtc
aggttcgtgctgaacagctcggcagcagacctcataatagaaaaagatgtgtgcatggga
gtcaggctatcagatggaggagagataagagctgagagcacgctcctcgcgcccggcagg
ataggcgcagagtggatcggggaggtgatcgagagatatggcattaaagcacggtatgga
cctctcgatgtcggggtgcgtgtggaggtgccatcgatagtcatggatcctgtcacgagg
atcaacagagatccgaagtttcacatcataactcacagatacgatgatttcataaggaca
ttctgcacaaaccctggggggtttgtggtcaaggaggagtacagggatttcatagcaaca
aacggacactcaatgtcaggggagcgatctgagaacacgaacttcgcatttcttgtcagg
cttgagctgacgaagccgatagagaacaccacagcatacggaatatcgatagcgaagctc
gtgacaactatcggcgggaggaggcccgtgatccagcggctcggagatctccacaggggg
aggagatcgaccggggagcggatcgccaggaaccctgtcaggaataccctgaaggatgtg
actccgggcgacatatcgatggctctgccccacaggatagtcatggatgtcatcgagggg
cttgagatcctgaatgagatcattccaggagtaaatgctgactccacgctgctttacgcg
ccggagataaaattctacgctcgtgagataagcgtcgacaaagacctgcagaccagcata
caatcactctacgctgcaggcgatggcgccggtctctcgagaggcatagtggcggccgct
gccaccggactgctcgcagcgcgcggaatactcagaggtgagtag

DBGET integrated database retrieval system