KEGG   Methanothrix thermoacetophila: Mthe_1413Help
Entry
Mthe_1413         CDS       T00417                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp00010  Glycolysis / Gluconeogenesis
mtp00620  Pyruvate metabolism
mtp00630  Glyoxylate and dicarboxylate metabolism
mtp00640  Propanoate metabolism
mtp00680  Methane metabolism
mtp00720  Carbon fixation pathways in prokaryotes
mtp01100  Metabolic pathways
mtp01110  Biosynthesis of secondary metabolites
mtp01120  Microbial metabolism in diverse environments
mtp01130  Biosynthesis of antibiotics
mtp01200  Carbon metabolism
Module
mtp_M00357  Methanogenesis, acetate => methane
mtp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mthe_1413
   00620 Pyruvate metabolism
    Mthe_1413
   00630 Glyoxylate and dicarboxylate metabolism
    Mthe_1413
   00640 Propanoate metabolism
    Mthe_1413
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mthe_1413
   00680 Methane metabolism
    Mthe_1413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtp01004]
    Mthe_1413
Enzymes [BR:mtp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mthe_1413
Lipid biosynthesis proteins [BR:mtp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mthe_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABK15188
UniProt: A0B914
Position
complement(1514971..1516941)
Genome map
AA seq 656 aa AA seqDB search
MVYEKAEVSSQENVYRPASDLVENSNVMQWMKRKGFRSEKELRAWCSENYVEFWDEMAKT
YADWFVPYEKVLEWNPPHARWFVGGKCNVAHNALDRHARSWRRNKVAYYFVGEPVGDTRA
ITYYQLYRDVNKLANGLKSLGVKKGDRVGIYLPMIPELPVAMLACAKIGAIHVVVFSGFS
AGALRERINDAGARVLITCDGSYRRGKPIPIKAQADEALQDAPSVERQIVYRRTGQSIEW
KDGFDIWWHELVKNQPDECETLQMDSEDPLFILYTAGAGGKPRGVVHAHGGFCVGPAYTT
SWVFDIKDTDVYWSTADIGWITGHTYIVYGPLCLGATSVMYEGSPDYPDFGRWFQIIEDY
GVSVIYTAPTAIRMFMKEGEEWPRKYDLRSVRLMGSVGEAMNPDAFLWWRKHVGNDWAPI
MDTWFQSETGCHVIAPLPITPLKPGSPAFPLPGYNVDLLDVNGRAVGPGESGNIVLTAPW
PTMLRGIYGEPEKLREIYYDYYWSIKPGIYLSGDRARRDADGYWWILGRIDDVLKVAGHR
ISNAEVESAALSHPNVADAAVIGRPDKVKGENIILFVVLKEGINPSEELKKDIRNHVRAT
MGPIAMPSEVYFVSAIPKDRTGKPVRAVIKAKALGAALGDTSSVINKDAIDAIPAI
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgaaaaagcagaggtatcctctcaggagaacgtctacaggccggcaagcgac
ctggtggagaactccaatgtgatgcagtggatgaagagaaagggattcaggagtgagaaa
gagctgcgggcctggtgttccgagaactacgttgagttctgggacgagatggcaaagaca
tatgcagattggtttgtgccgtacgagaaggtcctggagtggaacccaccgcatgcgaga
tggtttgtcggaggaaagtgtaacgtcgcgcacaacgccctcgacaggcatgcaagatcc
tggcgaagaaacaaggtcgcttactacttcgtgggtgagccggtcggagataccagggcc
attacatactatcagctctacagagatgtgaataagctcgcaaatggtctgaagagtctt
ggcgtgaagaagggcgacagggttggtatctacctgccgatgatccccgagctgccggtg
gcgatgctggcttgtgctaagatcggcgcgatacatgtcgtagtcttctccggattcagc
gcaggcgcgctccgcgagaggattaacgatgctggggccagagtcctgataacatgtgat
ggatcatacagaaggggcaagcctatcccgataaaggcccaagcggatgaggcccttcag
gacgcgccctctgtcgaacgccagattgtttacagacggactggccagagcatcgaatgg
aaggacggattcgatatctggtggcatgagctcgtgaagaaccagcctgatgagtgtgag
acgcttcagatggactcggaggatccgctcttcatactctacacagctggagctggagga
aagccgaggggtgttgtccatgcgcacggcggcttctgcgtcgggcctgcgtacacgacg
agctgggttttcgacataaaggatactgatgtgtactggtcgactgctgacatagggtgg
atcacaggccacacatacatagtatacggaccgctctgcctcggcgcgacgagcgttatg
tacgagggctctccggattaccctgatttcgggagatggttccagatcatagaggattac
ggtgtctctgtgatatacacagcgcccaccgcaatcaggatgttcatgaaggagggcgag
gagtggcctaggaagtacgacctgagaagcgtccggctcatgggatctgtgggagaggcc
atgaaccccgatgctttcctgtggtggagaaagcatgtcggcaacgactgggctcccata
atggacacatggttccagtcggagacaggatgccatgtgatagctccactgccgataacc
ccgctcaagccgggctcgcctgcattcccgcttcccggatacaacgttgatctccttgat
gtgaacgggagagcagttggtcctggagagagtgggaacatcgtgctcacagccccatgg
ccgacgatgctcagaggtatatacggagagccggagaagctcagggagatctattacgac
tactactggagcatcaaacctggtatatacctcagcggcgacagggcgaggagggatgct
gacggctactggtggatactcggaaggatagatgatgttctgaaggtcgcaggccacagg
ataagcaatgcagaggtcgagagcgcagcgctctcacatccgaatgtcgcggatgcagct
gtcatcggcaggccggacaaggtcaaaggagagaacatcattctcttcgttgtgcttaaa
gagggcatcaatccaagcgaggaactcaagaaggatatcaggaaccatgtcagggcgacc
atgggaccgatagcgatgccctctgaggtttacttcgtctccgccatacccaaggacaga
acgggaaagcctgttagggcagtgatcaaggcgaaggcacttggagcagctctcggcgat
acatcctctgtaataaacaaagatgccatcgatgccatacccgcgatttag

DBGET integrated database retrieval system