KEGG   Methanosaeta thermophila: Mthe_1415Help
Entry
Mthe_1415         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2TM CAAD
Motif
Other DBs
NCBI-ProteinID: ABK15190
UniProt: A0B916
Position
complement(1518871..1519152)
Genome map
AA seq 93 aa AA seqDB search
MAETLEEYKRLFREATVSDQVKLFQLHIAIYIVVNAIWIALNAMGTIKTIPGWAMYYPIV
GWGLLVVVHYWFYVRGAENLCKLREREIESRLG
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ttggctgagactctggaagagtataaaagactttttagagaggcgactgtctccgatcag
gtgaagctgttccagcttcacatagcgatctacattgtggtgaatgcaatctggatagcc
ctgaatgccatgggcacgataaagactatccctggctgggcgatgtactatcccatcgtg
gggtggggattgctggtggtggtgcattactggttctacgtgcgcggtgctgagaacctc
tgcaaactcagggaaagggagatagaatccaggctgggataa

DBGET integrated database retrieval system