KEGG   Methanosaeta thermophila: Mthe_1417Help
Entry
Mthe_1417         CDS       T00417                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_21 Fer4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ABK15192
UniProt: A0B918
Position
complement(1521203..1521511)
Genome map
AA seq 102 aa AA seqDB search
MAWLVGYPREKITWHPTIDREKCLKCGMCMNCGMNVYDWTEDGPVVARPNQCIVGCNTCA
NLCMGEAISFPDIKPIREIYKREHIWAKVKKQLEEEGKLKPK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcttgttggctatccgagagagaagataacctggcatcccaccatagatcgc
gaaaagtgcctgaagtgcgggatgtgcatgaactgtggcatgaacgtctacgactggaca
gaggatgggcctgtggtcgcaaggccgaatcaatgcatagttggctgcaatacgtgcgcg
aatctctgcatgggagaggcgatatcgttcccggatataaagcccatcagggagatctac
aagcgggagcatatctgggcgaaggtgaaaaaacagctcgaagaggagggaaagctgaag
ccaaagtga

DBGET integrated database retrieval system