KEGG   Methanosaeta thermophila: Mthe_1418Help
Entry
Mthe_1418         CDS       T00417                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ABK15193
UniProt: A0B919
Position
1521800..1522702
Genome map
AA seq 300 aa AA seqDB search
MNGRFWQVYRPIIVLLIVIVALAIWSYLSGGDQVSGAPLLTPLRGILLIAVGLAAGFLGG
LIGTGGCSIMLPVIHFWMGYSAPIAIGTTIFAVIFTAISGGYGHLIRKNLDRRATLWLAG
GGILGVIFGSWLFTILVEHIDLLQLILGLAFLLPAIRMIYEGIGRSKPKQEGDTIPGGSS
GFAVFGFAIGVLTGIVGLGGGYALVPGLIYLFGAPVYITMGTSLAVMIPMAVVAGGIKLV
QGFVALTTALILAAGTIVGAQIGAAVIKRFRPNTLKLIFGIYFLYVSLKFIAAYFGIAIW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagattctggcaggtatataggccgataatcgtacttctgattgttatagtg
gcactcgcgatctggtcatacctttctggaggggatcaggtgagcggtgcgccgctgctg
acccctctgagaggcatattgctgatcgccgtcggcctggcggctggcttccttggaggg
ttgatcggaactggcggatgcagcataatgctcccagtgatacacttctggatgggctat
tcagcgcccatcgcgatcggcacgacgatctttgccgtcatcttcaccgccatctccggg
gggtacgggcacctcataagaaagaatctggacagaagagcgacgctctggcttgcgggc
ggtggtattctcggcgtgatcttcggatcatggcttttcaccattctggtcgagcacata
gatctactccagctgattctcggattagcatttctgctgcccgcaataaggatgatctac
gagggcatcggccgctccaagcccaagcaggagggcgatacaatcccaggcggaagcagc
ggcttcgcggtctttggatttgcgattggcgttctgaccggaatagtgggacttggcggc
ggatatgcactcgtcccggggctgatctacctcttcggcgcacctgtgtacatcaccatg
gggacatccctggcggtcatgataccaatggcggttgtggcaggcggcataaagctcgtc
caggggtttgtcgcgctcaccaccgcgctaatcctcgcagccggaaccatagtgggagcg
cagatcggggcagcggtcatcaagaggttcaggccgaacacgctcaagctgatattcggc
atatacttcctctatgtatcgctgaagttcatagcggcatacttcggaatagcgatatgg
tga

DBGET integrated database retrieval system