KEGG   Methanothrix thermoacetophila: Mthe_1419Help
Entry
Mthe_1419         CDS       T00417                                 

Definition
(GenBank) LSU ribosomal protein L12AE
  KO
K02869  large subunit ribosomal protein L12
Organism
mtp  Methanothrix thermoacetophila
Pathway
mtp03010  Ribosome
Module
mtp_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Mthe_1419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mtp03011]
    Mthe_1419
Ribosome [BR:mtp03011]
 Ribosomal Proteins
  Archaea
   Large subunit
    Mthe_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ABK15194
UniProt: A0B920
Position
complement(1522768..1523085)
Genome map
AA seq 105 aa AA seqDB search
MEYIYAALLLHSSGKEVSDDGIKKVLEAAGVAPDEVRIKALVSALEGVDIDKILSQATAM
PVAAAAPAAAAAETEAKKPAAKAEEEEEKEEAEESGIEGLGALFG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggaatacatatatgcagcactgttactacatagctcaggcaaggaagtaagcgatgat
ggcataaagaaggtcctagaggcagccggtgtggcgcccgatgaggtcaggatcaaggcc
ctggtctcagcgcttgaaggtgttgatatcgataagatactctcccaggcgaccgccatg
ccggtagcggctgcagcccctgctgcggctgccgctgagaccgaggccaagaagcctgca
gccaaggcagaggaagaagaggagaaggaagaggcagaggagagcggcatcgagggactg
ggcgcgctcttcggttaa

DBGET integrated database retrieval system