KEGG   Methanosaeta thermophila: Mthe_1423Help
Entry
Mthe_1423         CDS       T00417                                 

Definition
(GenBank) LSU ribosomal protein L24A
  KO
K02601  transcriptional antiterminator NusG
Organism
mtp  Methanosaeta thermophila
Brite
Transcription machinery [BR:mtp03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Mthe_1423
Ribosome biogenesis [BR:mtp03009]
 Prokaryotic Type
  rRNA transcription factors
   Mthe_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spt5-NGN KOW Glyco_hydro_65C
Motif
Other DBs
NCBI-ProteinID: ABK15198
UniProt: A0B924
Position
complement(1525246..1525707)
Genome map
AA seq 153 aa AA seqDB search
MSETSIYVVKTTANQERAVANLVAQVARKEKLDIRAILVPDVLKGYVLVEASAPEIVEQA
IQGVPHARSVIKGASSFAEIEHFLTPKPAVVGISEGAIVELISGPFKGEMARVKRVDIAK
EEITVELFEAMVPIPITVRGDHVRVLSKEETQR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaccagcatatacgtagtcaagaccacagcaaatcaggagcgtgcggtcgcg
aatctggtcgcccaggtggctaggaaagagaagctggacatccgggcgatactagttcct
gatgtgctgaagggatacgtattggtggaggcttcagccccggagatagtggagcaggct
atccagggggttccacatgcgcgctctgtaataaaaggcgcatccagctttgcagaaata
gagcacttcctgacgccgaagcccgcagttgttggcataagcgagggcgccattgtggag
ctgatctcgggaccgttcaagggcgagatggccagggtgaagcgggtcgatatagcgaag
gaggagataaccgtggagctcttcgaggccatggtgcccataccaataacggttagaggg
gatcatgtgagagtccttagcaaagaagagactcagaggtga

DBGET integrated database retrieval system