KEGG   Methanothrix thermoacetophila: Mthe_1424Help
Entry
Mthe_1424         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_rich_KTR RecR zinc_ribbon_2 RNA_POL_M_15KD zf-ribbon_3 Terminase_GpA zf-NADH-PPase NOB1_Zn_bind
Motif
Other DBs
NCBI-ProteinID: ABK15199
UniProt: A0B925
Position
1525956..1526225
Genome map
AA seq 89 aa AA seqDB search
MHRRSSDTSYTARSCLITGAKEVAELEEDQSVLDQFVPFCPKCGNECLPKELRRALDAQS
WKKIIVETIYYCPRCDNYWSEGLVEKGYK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggaggtcaagtgacacgagttacacggccagaagctgtttgattacaggcgcg
aaggaggtcgcagagttggaggaagaccagagcgtgctcgaccagttcgtcccgttctgc
ccgaaatgcgggaacgagtgcctgcccaaggagctgcggagggctctcgatgcccagagc
tggaagaagatcatcgttgaaactatatattattgccccagatgtgataactactggagc
gaaggtctggtggaaaagggctataaatga

DBGET integrated database retrieval system