KEGG   Methanothrix thermoacetophila: Mthe_1425Help
Entry
Mthe_1425         CDS       T00417                                 

Definition
(GenBank) histone deacetylase superfamily
  KO
K04768  acetoin utilization protein AcuC
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    Mthe_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: ABK15200
UniProt: A0B926
Position
1526222..1527334
Genome map
AA seq 370 aa AA seqDB search
MIYLYYTDMFMGYSFGPEHPLQPARIMLTYRMIEEYGFFLGYDTEVQMPYYASEDDLLMV
HDPGYIQAVKEERPDPALGLDEPDTPVFPGIYDASALIAGASIEAAKRVASEPCVAFNLA
GGLHHAFPARAAGFCVFNDCALGIRTLRKRFDRVLYIDIDAHHGDGVQYIFYEDPSVLTI
SIHESGKYLFPGTGFVDEIGSGDGYGYSANIPMPLNADDECYRYAFESVIPALFRWFKPD
AVVAQLGVDTHYADPLASLDLTLEGYGYLVRRIKELTDEYAAGRMLALGGGGYNLEVVPL
AWTLAFQTLRGEKMPEELPKWWVDAIMKMIGRPPISLPDRPKKKSDVPRELIETVANLKR
RLTIIHGDIF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatctatctatactatacagatatgttcatgggctacagcttcggccctgaacacccg
ctgcagcctgcgcggatcatgcttacctacaggatgatcgaggagtacggtttcttccta
ggatacgacacagaggttcagatgccgtactatgcaagcgaggatgacctcctcatggtc
cacgatccagggtatatccaggcggtgaaggaagaacggccagatccagcgcttggcctg
gacgagcccgacactccagtattcccaggcatctacgacgccagcgcgttgatcgctgga
gccagcattgaggccgcgaagcgtgttgcatcagagccctgtgtggcgttcaacctcgcc
ggcggtctccatcacgcgtttccggccagagcagcaggattctgcgttttcaacgattgc
gctctcggaattcgcacactgaggaagcgcttcgacagggttctctacatagatatcgat
gctcatcacggcgatggtgtgcagtacatcttctatgaggatccatcagtactgactata
tccatccacgagtctggaaagtacctctttcccggaactggattcgtggacgagatcggc
agcggcgatgggtatgggtactccgcgaacataccgatgccgctgaatgcggatgatgaa
tgctacaggtacgccttcgagtctgtcatccccgcgctgttcagatggttcaaacctgat
gcagtcgtcgcgcagctcggcgtcgatacgcattatgcagatccccttgcgagcctcgat
ctgacgcttgaaggctacggctatctcgttcggaggataaaggagctcacagatgagtat
gcggccggcaggatgctcgccctgggcggaggcggctacaacctggaggtcgtgccgctt
gcatggacgctggcattccagactttgagaggggagaagatgccagaggagctcccgaag
tggtgggttgatgcgataatgaaaatgatcggaagaccacctatatctcttccggatcga
ccaaagaagaagagcgatgtcccaagggagctgatcgagaccgtggcaaacctgaaaaga
aggctgaccataatacacggcgacatattctga

DBGET integrated database retrieval system