KEGG   Methanothrix thermoacetophila: Mthe_1427Help
Entry
Mthe_1427         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanothrix thermoacetophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3147 Acyl_transf_3
Motif
Other DBs
NCBI-ProteinID: ABK15202
UniProt: A0B928
Position
1528669..1528998
Genome map
AA seq 109 aa AA seqDB search
MRLLIYFLLGGIITALVVHLGSSGRGTLSAFIATFPVLTALTFILISMEGSSADFCEYAR
GLLIFTPAWIAYVLTVLITFERIGVWLSIALGMVVYAVASWLLRVAIIH
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgctgatatacttcttgcttggtgggatcatcacagcgctcgtcgtccatctc
ggcagctcgggccgcgggacgctctcagcgttcatcgccacgtttccagtgctcacagcc
ctcacattcatactgatatccatggagggaagcagcgctgatttctgcgagtatgcgaga
ggccttcttattttcacgcctgcctggatcgcatatgtactgactgtgctgatcaccttt
gaacgcattggcgtttggctatcaatagcattgggtatggtggtatatgcagtggcgtcg
tggcttctgagggttgccatcatccactaa

DBGET integrated database retrieval system