KEGG   Methanosaeta thermophila: Mthe_1432Help
Entry
Mthe_1432         CDS       T00417                                 

Definition
(GenBank) Phosphopantothenate-cysteine ligase / Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00770  Pantothenate and CoA biosynthesis
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mthe_1432
Enzymes [BR:mtp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Mthe_1432
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Mthe_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ABK15207
UniProt: A0B933
Position
1532674..1533912
Genome map
AA seq 412 aa AA seqDB search
MNSEHHVMELSISGTVSDTLAGRTVALGVTGSIAAVRVVDLVRDLIRRGADVHCVMSEAA
QRILHPYALEYASGNPVITEITGRVEHVELCGVEGRADMLLIAPATANTIGKIACGIDDT
PVTTFATTAIGSGKPVAVVPAMHEAMYRHHAVVENLNRLRSMGVVCIDPRIEESKAKIAE
NSRIVAEVERILGPRDLRSRRILVTSGATAESIDPIRIITNRASGRTGVEIAREAYRRGA
DVTIIHRARLGLPFKEIYVESAQDTLDAVMKELSGGYDALIGAAAVGDFTVDTEQRKIKS
KEELVLRLKPAPKILRSVRSMYPDLTIIGFKAETFVSDEDLLRSARESMDASRLDLVIAN
DVGAGGMGTDDNRVLILRYDGSHAEVSGKKTIIARRVIDELVRILNGKDKGC
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagagcatcacgtgatggagcttagcatctctggaactgtcagcgataccctt
gcgggaaggacggtggctctgggcgtcaccgggagcatcgcggccgtgagggttgtcgac
cttgtgcgcgacctcatcaggcgcggcgcagatgtgcactgcgtgatgtctgaggcggca
cagaggatactgcatccatatgctcttgaatatgccagtggcaatccggtgatcactgag
ataaccggccgtgtcgagcacgtggagctctgtggagttgagggtcgcgcggatatgctt
ctaatagcccctgccaccgcgaacacgataggaaagatcgcatgcggcatagatgatacg
cctgtcacgaccttcgccaccaccgcgatagggagcggaaagccggtcgctgtggtgcct
gcgatgcacgaggcgatgtaccgccaccatgctgtcgtcgagaacctgaataggctcaga
tcgatgggagttgtgtgcatagaccccaggatcgaggagtctaaggcgaagatcgctgaa
aactcacggatagtggctgaggttgagcggattctgggaccgagggatctcagatcgagg
cgcattcttgtgaccagcggcgcaaccgctgagagcatagatccgatcaggataataaca
aaccgtgcctcaggaagaaccggcgtggagatagcgcgcgaggcctacaggcgcggcgcg
gatgtgacgatcatccacagggccaggctggggctgccatttaaggaaatatacgtcgaa
agcgctcaggatacgcttgacgctgttatgaaagagctctcaggcgggtacgatgccctc
ataggtgcagcagccgtcggcgacttcaccgtggacacagagcagagaaagatcaaatcg
aaggaggagcttgttctgagactcaaacctgccccaaagatactgaggtctgtgcgctca
atgtatccagatctcaccatcatcgggttcaaggccgagacattcgtgagcgatgaggat
ctgctcaggagcgctcgcgaatccatggacgcatcgcgcctggatctcgtgatcgcgaat
gatgtgggtgcaggtggaatgggaactgacgataacagggttctgattttgagatatgat
ggctcgcacgcagaggtctctggaaagaagaccatcatcgcgagaagggtgatcgacgag
cttgtgaggatcctgaatggtaaagataagggatgctga

DBGET integrated database retrieval system