KEGG   Methanosaeta thermophila: Mthe_1434Help
Entry
Mthe_1434         CDS       T00417                                 

Definition
(GenBank) pantothenate synthetase
  KO
K09722  4-phosphopantoate---beta-alanine ligase [EC:6.3.2.36]
Organism
mtp  Methanosaeta thermophila
Pathway
mtp00410  beta-Alanine metabolism
mtp00770  Pantothenate and CoA biosynthesis
mtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtp00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mthe_1434
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mthe_1434
Enzymes [BR:mtp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.36  4-phosphopantoate---beta-alanine ligase
     Mthe_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPS_PS DUF773
Motif
Other DBs
NCBI-ProteinID: ABK15209
UniProt: A0B935
Position
1534800..1535585
Genome map
AA seq 261 aa AA seqDB search
MTDIPKSHPRYASLMARERIADGVRNGITSAQGMIAQGRGETFDYILGERTMRSADRATL
AAAAALLLAERPALSVNGNVAALVPAEMVELASLLNAPLEVNLFHRSEDRVRKIADLLRS
HGARMVLGESPDCRVPGLEHSRALATRGGIYDADVVLIPLEDGDRCEALVRMGKTVIAID
LNPLSRTSMKASISIVDNIMRAVPNLIGKIRSLSGSPREDLQAILRDYSNRNTLSDALLE
MQEYITARMRELDTAGRSAGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgactgatataccgaagtcgcatccgagatacgcgtctctgatggcacgcgagaggata
gcagatggtgtgagaaacgggataacaagcgcccaggggatgatcgcgcagggcagaggc
gagacattcgattacattctcggagagaggacgatgagatctgcggacagggccacacta
gcagcagctgcagctcttctcctcgcggagaggccggcactcagtgtgaacgggaatgtt
gcggctctcgtccccgcggagatggtagagctcgcatctctcctgaatgcgcctctcgag
gtgaacctgtttcacaggagcgaggatcgggtgagaaagatcgcagatctcctcagatct
cacggcgcacgcatggtgcttggagagagcccggattgcagggtgccgggactagagcac
agccgtgctcttgccacgaggggtggcatatatgatgctgatgttgtgctgatacccctc
gaggacggcgacaggtgcgaggcgcttgtgaggatgggaaagactgtgatagccatagat
ctcaatcccctctcaaggacgtccatgaaggccagcatatcaattgtggataacataatg
agagcggtgccaaatctcattgggaagataagatctctctcaggatctcccagagaggat
cttcaggctatactgcgggattacagcaacaggaacacattgagcgatgctctgctcgag
atgcaggagtacatcactgcaaggatgcgtgagcttgatactgcagggcgctcagccggt
aggtaa

DBGET integrated database retrieval system