KEGG   Methanothrix thermoacetophila: Mthe_1436Help
Entry
Mthe_1436         CDS       T00417                                 

Definition
(GenBank) Protein of unknown function DUF1621
  KO
K09152  uncharacterized protein
Organism
mtp  Methanothrix thermoacetophila
Brite
KEGG Orthology (KO) [BR:mtp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mthe_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SepF
Motif
Other DBs
NCBI-ProteinID: ABK15211
UniProt: A0B937
Position
1536012..1536371
Genome map
AA seq 119 aa AA seqDB search
MVKFLERLMGRPPTDEYVEVDLGQFEDEPERPRAYLRVAELTSLDVLPEIKQEIRSQNIL
LIDIAPMKRDKASLDRAIGELRKIVEDMAGDIAGVGDDLVIIVPSGIRIDREKVVGGKD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagttccttgaaagactgatgggtaggccacccacagatgaatacgtggaggtg
gaccttggccagttcgaggatgagcctgagcggccgagggcttatctcagagtggccgag
ctcacgtccctcgatgtgctgccggagataaagcaggagattcgatcccagaatatactg
ctgattgatatagcgcccatgaagagagacaaggcatctctggacagggcgataggtgag
cttaggaagatcgtcgaggatatggccggggatatagctggagttggagatgatctggtc
ataatagttccgagtggtataagaatcgacagggagaaggttgtgggaggaaaagattga

DBGET integrated database retrieval system