KEGG   Methanosaeta thermophila: Mthe_1437Help
Entry
Mthe_1437         CDS       T00417                                 

Definition
(GenBank) ZPR1-related zinc finger protein
  KO
K06874  zinc finger protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-ZPR1 AtuA
Motif
Other DBs
NCBI-ProteinID: ABK15212
UniProt: A0B938
Position
1536368..1536943
Genome map
AA seq 191 aa AA seqDB search
MKLKTKASCPMCGATMEFNWETTELPYFGDALIIGGVCECGFRHSDTMLLSQREPYRHTL
VVREIEDLNARVLRSSSGTIHIPEIGVDIEPGYASEAYITNIEGVLVRVKNIVEFATNAA
RQARDVERTAKGEEILSKIEMALRGEFSLTVILEDPFGNSAIISEHVVATPLSIEEASNL
KTGMIVLDLSE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctcaagacgaaagcgagctgccccatgtgcggggcgacgatggagttcaactgg
gagacgacagaactgccgtacttcggtgacgccctcatcatcggaggggtatgcgagtgc
ggcttcaggcacagcgatacgatgcttctgagccagcgcgagccgtacaggcacactctt
gttgttagggagattgaggacctgaatgccagggttctcagatcatccagcggcacgatc
cacatacccgagatcggcgtggacatcgagcccggatacgcatctgaggcgtatataaca
aacatcgagggcgttcttgtcagggtaaagaacatcgtcgagttcgcaacgaacgccgcg
agacaggcccgggatgtggagaggaccgcaaagggcgaggagatactctcaaagatagag
atggcgctaaggggcgagttcagcctaacggtgatcctggaggatccattcggaaacagc
gccataatatcagagcacgttgtggcaacgcctctatccatagaggaggccagcaatctg
aagacgggcatgatagttcttgacctctccgagtga

DBGET integrated database retrieval system