KEGG   Methanosaeta thermophila: Mthe_1455Help
Entry
Mthe_1455         CDS       T00417                                 

Definition
(GenBank) hypothetical protein
Organism
mtp  Methanosaeta thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ada_Zn_binding
Motif
Other DBs
NCBI-ProteinID: ABK15229
UniProt: A0B955
Position
1556469..1557230
Genome map
AA seq 253 aa AA seqDB search
MFRFIPLICGLLALTFVQGCVEQKAAEQSGFVDVHTYKKLDLEFESGISSELFRVWGTLD
LTSNSSEPYLLLEAALLREGQEVLRSKYLLIDVAPGQTAFEFSKAARLYPGRGYTCRLVV
SDADGPIQSAERTVHILESSLEESIYPPSLSFSEPAEAPARNGDDTAEDQEDRSEEDETG
KNTKDDEAGLNVTDRSAEPGQDGAKYVGSATSRKYHLPDCRYARKIKPEHLVVFSSKEEA
EARGYEPCKVCNP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaggtttatcccacttatatgcggtttgttggctctgacgtttgttcaggggtgt
gttgagcaaaaagctgctgagcagagcggctttgtggacgtccatacgtataaaaagctc
gatctcgagttcgagtccggaatctccagcgagctcttccgggtatggggcacgctggac
ctcacctccaacagttccgagccttatcttctgcttgaggcagctcttttgagagaaggt
caggaagtcttgcggtcgaaatacctgctgatcgatgtggctccaggtcagactgcattc
gagttctcaaaggctgcaagactgtaccctggcaggggctacacatgccgccttgtggtt
tctgatgctgatggcccaattcaaagcgccgagcgtacagttcatatcctggagagcagc
ctggaagagtcgatatatccgccgtcgctttcattcagtgagcctgccgaagcgccggcc
agaaatggggatgataccgcggaagatcaggaagatcgatctgaggaggatgagacagga
aaaaatacgaaagatgacgaagcaggtctcaatgtcacagacagatctgcagagcctggg
caggatggtgcgaagtacgtcgggagcgccacctccaggaaataccatcttccagattgc
cggtacgccaggaagataaagcctgagcaccttgtagtcttctcgagcaaggaggaggca
gaagccagagggtatgagccatgcaaggtgtgcaatccctga

DBGET integrated database retrieval system