KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_1960Help
Entry
HKBS1_1960        CDS       T03154                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00071  Fatty acid degradation
mtq00072  Synthesis and degradation of ketone bodies
mtq00280  Valine, leucine and isoleucine degradation
mtq00310  Lysine degradation
mtq00362  Benzoate degradation
mtq00380  Tryptophan metabolism
mtq00620  Pyruvate metabolism
mtq00630  Glyoxylate and dicarboxylate metabolism
mtq00640  Propanoate metabolism
mtq00650  Butanoate metabolism
mtq00900  Terpenoid backbone biosynthesis
mtq01100  Metabolic pathways
mtq01110  Biosynthesis of secondary metabolites
mtq01120  Microbial metabolism in diverse environments
mtq01130  Biosynthesis of antibiotics
mtq01200  Carbon metabolism
mtq01212  Fatty acid metabolism
mtq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBS1_1960
   00630 Glyoxylate and dicarboxylate metabolism
    HKBS1_1960
   00640 Propanoate metabolism
    HKBS1_1960
   00650 Butanoate metabolism
    HKBS1_1960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HKBS1_1960
   00072 Synthesis and degradation of ketone bodies
    HKBS1_1960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBS1_1960
   00310 Lysine degradation
    HKBS1_1960
   00380 Tryptophan metabolism
    HKBS1_1960
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBS1_1960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBS1_1960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HKBS1_1960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtq04147]
    HKBS1_1960
Enzymes [BR:mtq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBS1_1960
Exosome [BR:mtq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBS1_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHJ42606
Position
2098283..2099767
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgaggc
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggagtggactgtgcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgctgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcgacacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctggcggccaatcccgggcgccgaggt
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcggaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccgga
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggcaccgcgaccctgcgatag

DBGET integrated database retrieval system