KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_2762Help
Entry
HKBS1_2762        CDS       T03154                                 

Gene name
pgsA1
Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00564  Glycerophospholipid metabolism
mtq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HKBS1_2762 (pgsA1)
Enzymes [BR:mtq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     HKBS1_2762 (pgsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF4229
Motif
Other DBs
NCBI-ProteinID: AHJ43408
Structure
PDB: 

Position
complement(2931926..2932579)
Genome map
AA seq 217 aa AA seqDB search
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACV
VWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIA
TLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVG
MWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcccttcctgtcccgggcggcgttcgcccggattaccaccccgatcgcc
aggggactgctgcgggtcggcctcacgccggacgtcgtcaccatcctgggcaccaccgcg
tcggtggcgggagcgctgacgctgttcccgatgggcaagctgttcgcgggtgcgtgtgtg
gtgtggttcttcgtgttgttcgacatgctggacggggcgatggcccgggagcgcgggggc
ggcactcgcttcggcgcggtgctggacgccacctgtgaccgcatcagtgacggcgcggtg
ttctgcggtctgctgtggtggatagcgtttcacatgcgcgaccgaccgctggtgatcgcg
accttgatctgtctggtcacctcgcaggtgatctcttacatcaaggcccgggcggaggcc
agcgggctgcgcggcgacggcggcttcatcgaacggccggaacggttgatcatcgtgctg
accggcgccggggtgtcggacttcccgtttgtgccctggccgccggcgttgtcggtgggg
atgtggctgctggccgtcgccagcgtgatcacctgcgtgcagcggttgcacacggtctgg
acttcacccggagccatcgatcggatggcgattcctggaaagggcgaccggtga

DBGET integrated database retrieval system