KEGG   Mycobacterium tuberculosis HKBS1: HKBS1_3769Help
Entry
HKBS1_3769        CDS       T03154                                 

Gene name
fadA6
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mtq  Mycobacterium tuberculosis HKBS1
Pathway
mtq00071  Fatty acid degradation
mtq00072  Synthesis and degradation of ketone bodies
mtq00280  Valine, leucine and isoleucine degradation
mtq00310  Lysine degradation
mtq00362  Benzoate degradation
mtq00380  Tryptophan metabolism
mtq00620  Pyruvate metabolism
mtq00630  Glyoxylate and dicarboxylate metabolism
mtq00640  Propanoate metabolism
mtq00650  Butanoate metabolism
mtq00900  Terpenoid backbone biosynthesis
mtq01100  Metabolic pathways
mtq01110  Biosynthesis of secondary metabolites
mtq01120  Microbial metabolism in diverse environments
mtq01130  Biosynthesis of antibiotics
mtq01200  Carbon metabolism
mtq01212  Fatty acid metabolism
mtq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mtq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HKBS1_3769 (fadA6)
   00630 Glyoxylate and dicarboxylate metabolism
    HKBS1_3769 (fadA6)
   00640 Propanoate metabolism
    HKBS1_3769 (fadA6)
   00650 Butanoate metabolism
    HKBS1_3769 (fadA6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HKBS1_3769 (fadA6)
   00072 Synthesis and degradation of ketone bodies
    HKBS1_3769 (fadA6)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HKBS1_3769 (fadA6)
   00310 Lysine degradation
    HKBS1_3769 (fadA6)
   00380 Tryptophan metabolism
    HKBS1_3769 (fadA6)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HKBS1_3769 (fadA6)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HKBS1_3769 (fadA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HKBS1_3769 (fadA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtq04147]
    HKBS1_3769 (fadA6)
Enzymes [BR:mtq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HKBS1_3769 (fadA6)
Exosome [BR:mtq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HKBS1_3769 (fadA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHJ44415
Position
complement(3991569..3992729)
Genome map
AA seq 386 aa AA seqDB search
MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG
GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS
QIPISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERYSL
TSHERAFAAIRAGHFENEIITVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMA
SQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLFTTMLGELE
RIGGRYGLQTMCEGGGTANVTIIERL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcgtacgtcatcgacgccgtacggaccgcggtcggcaagcggggcggcgca
ctggccggtatccatcccgtcgacctgggtgccctggcctggcgcggactgctggaccgg
accgacatcgaccccgccgccgtcgacgacgtgatcgccggatgtgtcgacgccatcggc
ggacaggcgggcaacatcgcccgactgtcgtggctggccgccggctatcccgaagaggtc
cccggtgtcaccgtggaccgccagtgcggatccagccagcaggcgatttcctttggcgcg
caggcgatcatgtccggcacggcggatgtcatcgtggccggcggcgtgcagaacatgagc
cagatcccgatctcgtcggcgatgaccgtgggcgaacagttcgggttcacctcgccgacc
aacgaatccaagcaatggttacaccggtatggcgaccaggagatttcacagttccgtggc
tcggagctgatcgccgagaagtggaacctgtcccgtgaagagatggagcggtactcgctg
accagccacgaacgcgcgttcgcggcgatccgcgccggccacttcgaaaacgaaatcatc
actgtggaaaccgaatccgggccgttccgggttgatgagggcccgcgggagtcgtcgctg
gagaagatggccggcttgcagccgctggtcgagggcggccggctgacggcggcgatggcc
agtcagatctccgacggcgccagtgcagtgttgctggcctccgagcgggccgtcaaagac
catggacttaggccccgtgcccgcatccaccacatcagtgcgcgcgccgccgacccggta
ttcatgctgaccggacccatccccgccacccggtacgcgctggacaagaccgggcttgcc
atcgacgacatcgacaccgtcgagatcaacgaggcgttcgcgccggtagttatggcctgg
ctcaaggaaatcaaggccgacccggcgaaggtcaaccccaacggcggcgcgatcgcgctg
gggcatccgctaggcgccaccggcgccaaactgttcaccaccatgctgggcgagctggag
cgcatcggtggccgctacgggctgcagaccatgtgcgagggcggcggcaccgccaacgtc
accattatcgagcggctgtag

DBGET integrated database retrieval system