KEGG   Medicago truncatula (barrel medic): MTR_0279s0040Help
Entry
MTR_0279s0040     CDS       T01716                                 

Definition
(GenBank) DEAD-box ATP-dependent RNA helicase-like protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtr03041]
    MTR_0279s0040
   03009 Ribosome biogenesis [BR:mtr03009]
    MTR_0279s0040
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MTR_0279s0040
Spliceosome [BR:mtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    MTR_0279s0040
Ribosome biogenesis [BR:mtr03009]
 Eukaryotic type
  90S particles
   Helicases
    MTR_0279s0040
  Pre-60S particles
    MTR_0279s0040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C
Motif
Other DBs
NCBI-ProteinID: KEH16204
UniProt: A0A072TF73
Position
Unknown
AA seq 116 aa AA seqDB search
MQVPNEGCFQGYVFVPCAKRFMVLYSFLKRHKSKKVMVFFSSCNSVKFHADIFNHIHLHC
SSIYGKQKQQTRTTTFVDFCQAEKGILLCTDVAARGLDIPSVVYTSFISTYMKFFK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaccaaatgaagggtgctttcagggttatgtgtttgttccctgtgccaagcga
tttatggttctttattccttcttgaagaggcacaaatcgaaaaaagtgatggtctttttc
tcttcatgcaacagtgtcaaattccatgcagacatttttaatcacattcatttgcattgt
tcaagtatttacggaaaacaaaagcagcagacccggacaactacttttgttgacttctgc
caagcagaaaagggcatcttgctctgtactgacgttgctgctcgtggactggacatacct
tctgtggtatatacatctttcatatctacctacatgaaattttttaaatag

DBGET integrated database retrieval system