KEGG   Medicago truncatula (barrel medic): MTR_1g015940Help
Entry
MTR_1g015940      CDS       T01716                                 

Definition
(RefSeq) fructan exohydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00052  Galactose metabolism
mtr00500  Starch and sucrose metabolism
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MTR_1g015940
   00500 Starch and sucrose metabolism
    MTR_1g015940
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MTR_1g015940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 11422725
NCBI-ProteinID: XP_003588976
UniProt: G7I9W6
Position
1
AA seq 480 aa AA seqDB search
MQTPRVQLVTCISCILQHVNACNHPLCHHALHEKCNFSFMHHGHVSCYKSAVSFTYNPAA
ATFGHEKMVWGHSISNDLINWTHLNDAIVPTIPGDINSCWSGSATILPGEKPAMLYTGID
QNRHQVQNLAMPKNLSDPYLREWEKHPQNPLMTPPSGVEVGEFRDPSTAWQGKDGKWRVI
IGAQNGDEGKIILYKSEDFVKWIVDPIPFFATDDTGVCECPDFFTVYINSTNGVDTTMEN
SSVRHEKFIPDVNYTGTCKDLRFDYGLFYASKSFFDYAKNRRILWGWVEENDSEQDEIDK
GWAGLQTIPRKFWLDESGERLMQWPIEELEKLGGNQINITGETLQSGSTLEVKGITASQA
DVEVLFGLPDLQSAELLEPSETNPQELCKEQYASRKCMIGPFGLQALASKDQTEKTTISF
RIYRVADHYKCLMISDQTRSSLRQDLKKLIYATIFDIDPNLKTISLRSLVYLFFIIFVFM
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactccaagagtgcaacttgtcacttgcatctcatgcatcttgcaacatgtcaat
gcatgcaaccatccactttgccaccatgcattacatgagaagtgcaacttttctttcatg
caccatggacatgtgtcttgctacaaaagtgccgtatcattcacatataaccctgctgca
gcaacatttggtcatgagaaaatggtatggggtcattctatatcaaatgatctcataaat
tggactcatctaaatgatgctattgtaccaactatacctggtgacataaacagttgttgg
tcaggttcagccactatactcccaggtgaaaaacctgctatgttgtatacaggaattgat
caaaatagacaccaagttcaaaatttagccatgccaaagaatctgtctgatccttactta
agggaatgggaaaaacatcctcaaaatcctttgatgactccacctagtggagttgaagtc
ggtgaattccgagatccttcaactgcatggcaaggaaaggatggaaaatggagggtaatt
attggtgctcaaaatggagatgaaggaaaaattattctttacaaaagtgaggattttgtt
aagtggatagtggatcctatacctttctttgcaacagatgataccggagtttgtgaatgt
ccggatttttttactgtgtatatcaatagtacaaatggggtggatacaactatggaaaat
tcaagtgttagacatgaaaaatttattcctgatgtaaattatacaggaacttgcaaagac
ttaagatttgactatggccttttttatgcttcaaagtcattttttgactatgctaagaat
aggagaatattatggggatgggtggaggaaaatgactctgaacaagatgagattgataaa
ggatgggctggtttacagactattccaaggaagttttggcttgatgaaagtggggagaga
ttaatgcagtggccaattgaagagttagaaaaacttggtggcaatcaaatcaatatcact
ggagaaacactccaaagtggatcaactcttgaagtaaaaggtatcactgcatcacaggct
gatgtggaagttttgtttgggctacctgatctacaaagtgctgagctgctagaaccaagt
gaaactaatcctcaagaactctgtaaagaacaatatgcatcaagaaaatgcatgataggg
ccatttggtttgcaagccttagcatcaaaagaccagacagagaagactacaatatctttc
cggatatatagagtcgcggatcattataaatgtttgatgataagtgaccagaccaggtct
tcattgaggcaggatcttaagaaactcatatatgcaactatctttgacatagatcccaat
ctcaaaacaatttcactcagaagcctggtatatttattttttatcatatttgtgtttatg
tga

DBGET integrated database retrieval system