KEGG   Medicago truncatula (barrel medic): MTR_1g018280Help
Entry
MTR_1g018280      CDS       T01716                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00450  Selenocompound metabolism
mtr00970  Aminoacyl-tRNA biosynthesis
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MTR_1g018280
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MTR_1g018280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtr01007]
    MTR_1g018280
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mtr03016]
    MTR_1g018280
Enzymes [BR:mtr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MTR_1g018280
Amino acid related enzymes [BR:mtr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MTR_1g018280
Transfer RNA biogenesis [BR:mtr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MTR_1g018280
 Prokaryotic type
   Other AARSs
    MTR_1g018280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AES59334
UniProt: G7ICD3
Position
1
AA seq 461 aa AA seqDB search
MGMKWGYPNPSRMRFNFSSPLDMGRVMGKYMRIGYRDGEGKTRPHPTPLQCLLSPEPKRL
LGKKVIFITGTDEHGEKIATAATVQGSTPTDHCNLISQAYKTLWNDLDISYDKFIRTTDS
KHVAVVKEFYSRVLANGDIYRADYEGIYSVSCEEYKDEKELLENNCCPIHLKPCVSRKED
NYFFALSKYQNYISALADDQVQEQPDLLNTVSSSWPATLHLIGKDILRFHAVYWPAMLMS
AGLSLPKIVYGHGFLTKDGMKMGKSLGNTLEPNDLVSKFGTDAVRYFFLREVEFGNDGDY
SEERFINIVNAHLPNTIGNLLNRTLGLLKKNCQSTLAVDSTTAAEGNGFKDNVARLVDKA
HMHYENLSLTSACEAVLEIGNAGNSYMDERAPWSLFKQGGTASEAAAKRDTKWGGLEGGQ
VMAQPQPVFARIEVEDKGVAVGKKTLKSKGKSKQAQEVVGA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggggatgaagtggggatacccgaatccgtcgaggatgagattcaatttctcatccccg
ttggatatgggtagggtaatgggtaagtatatgagaatcgggtatagggacggggaaggt
aaaactcgtccccaccccaccccattgcaatgcctactctcgccggaacctaagcggctt
ttgggaaagaaagttatattcattactggcaccgatgaacacggtgagaaaattgcaact
gctgccactgttcagggttccacccctactgaccactgcaatctcatttcacaagcttac
aagacgctttggaatgatctagatatttcatatgataagttcattagaacaacggatagc
aagcatgtagcagttgtgaaggaattttattcgagagtgcttgccaatggtgacatttac
cgagctgattatgagggaatttattctgtcagctgtgaagaatataaggatgagaaggaa
ctgcttgaaaataattgttgtccgatccaccttaagccttgtgtttcaaggaaagaggac
aattattttttcgcactgtcaaaatatcagaactacatatcagcactagctgatgaccag
gtccaggagcaacctgatttactaaacaccgtttcttcaagttggccagctacactgcac
ttgattggtaaggatattctacgtttccatgccgtttattggccagctatgctaatgtct
gctgggctaagccttcccaaaattgtatatggccatggattcttgacaaaggatggtatg
aagatgggcaaatcactaggaaatacgcttgaaccaaacgatttggttagtaagtttggg
acagatgcagttagatacttcttcctcagagaggtggaatttggcaatgatggggactat
tcagaggaacgcttcatcaatattgtaaacgcacatcttcccaatacaattggaaatctt
cttaataggactctaggacttctgaaaaagaattgccaatcaacactggcagtggattcc
actacggctgcagaaggaaatggattcaaggacaatgtagcgaggctggttgataaagct
catatgcactatgaaaatctctccctgacatcagcttgtgaggctgttctggagattggt
aatgctggtaattcctatatggacgagcgtgccccttggtctctctttaagcaaggaggt
actgcttctgaagcagctgccaagagagataccaagtggggtggacttgagggtggtcag
gtcatggctcaacctcaaccagtctttgctaggattgaagtggaagacaaaggggttgca
gtcggtaagaagactctgaaaagtaaagggaagtcgaaacaagctcaagaagttgttgga
gcttag

DBGET integrated database retrieval system