KEGG   Medicago truncatula (barrel medic): MTR_1g022420Help
Entry
MTR_1g022420      CDS       T01716                                 

Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00220  Arginine biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01230  Biosynthesis of amino acids
Module
mtr_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MTR_1g022420
Enzymes [BR:mtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     MTR_1g022420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N OCD_Mu_crystall Glyco_hydro_101
Motif
Other DBs
NCBI-GeneID: 25482166
NCBI-ProteinID: XP_013466132
UniProt: A0A072VEY9
Position
1
AA seq 367 aa AA seqDB search
MAILSFNFSVQSERSSFFPAVLPSSSSSLSQISCPRISTSHFPLKISCHVTSIESASVVE
KTKVKDFIHINDFDKETIKKILDRAIEVKELIKSGERTFQPFKGKTLAMVFAKPSLRTHV
SFETGFSLLGGHAVYLAPEDIQMGSREETRDVARILSRFTDIVMARVFTHKDILTLSKYA
TVPIINGLTDYNHPCQIMADAITLIEHLGRLEGSKVAYVGDGNNVVHSWLELASLFPIHF
TCATPKGFEPDAKTVAKARQAGISKIVITNDPKEAVKGADIVYTDVWASMGQKEEAQKRR
LMFKGFQVDQNLMDLAGSNALFMHCLPAEKGVEVTEEVIEGPKSIIFAQAENRLHAQNAI
MLHVLGE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcaatactttctttcaacttttcagtgcaatcagagagatcaagcttcttcccagct
gtgcttccatcatcgtcttcttctttatctcaaatttcctgccctagaatttccacgtcc
cattttcccctcaaaatatcgtgccatgtcacttccattgaatcagcttctgtcgtggaa
aaaaccaaggtgaaggattttattcacataaatgattttgacaaggagactattaagaag
atcttggacagggccattgaggtgaaagaattaataaaatcaggggaaaggacatttcaa
ccgtttaaaggtaaaacattggcaatggtgtttgcaaagccatcattgagaacacacgtc
tcatttgagactggcttttcattgttgggtggacatgctgtgtacttagcacccgaggat
atccaaatggggtcaagagaggagactcgtgatgttgctcgtatcttgtctcgctttact
gacattgttatggctcgtgtttttactcacaaggacatacttactctttcaaagtatgca
actgtaccaatcatcaatggattgacagattacaatcacccttgccagataatggctgat
gccatcactctaattgagcaccttggtcggcttgaaggctccaaggttgcgtatgttgga
gatggaaataatgttgtccattcatggttggagcttgcaagtttatttccgattcacttc
acatgtgctactccaaagggctttgaaccagatgcaaaaacagttgcgaaggcacgccaa
gctggaatcagcaagattgtgataactaatgatcctaaagaggcggtgaaaggagctgat
attgtttacactgatgtttgggcaagcatggggcaaaaggaagaggctcaaaagcgccgt
ttgatgttcaagggatttcaggtggaccaaaatctcatggatttagctggctcaaatgca
ttattcatgcattgcttgccagcagaaaaaggagtggaggtgaccgaggaagttattgaa
ggtccaaagtcaattatctttgcacaagctgagaatcgattacatgcacagaatgccata
atgctacatgtgcttggcgagtaa

DBGET integrated database retrieval system