KEGG   Medicago truncatula (barrel medic): MTR_1g023985Help
Entry
MTR_1g023985      CDS       T01716                                 

Definition
(GenBank) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MTR_1g023985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtr03041]
    MTR_1g023985
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MTR_1g023985
Spliceosome [BR:mtr03041]
 Complex C
  Other components
   Step II factors
    MTR_1g023985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD ABC_tran AAA_16 AAA_14 PhoH
Motif
Other DBs
NCBI-ProteinID: KEH40209
UniProt: A0A072VDW1
Position
1
AA seq 1223 aa AA seqDB search
MGSDIPQDGLKKLEYLSLVSKVCTELESHTGTSDKVLAEFITDLGHSSNSVEEFDAKLKE
NGAEMPDYFVRTLLTIIHAILPPKPKKQRENLKENANSNTKFKALAISDDRGRAEKLREE
IEIEAREKQKPPMEDDDGYRDRDRRDRHRDRYDRRGNDRDRDRRERDDKRGSDRDRGDRR
DRDDTRGNARDRDRYEKDDKRRDDRDRDRYERDDKRGNDRDRDRDRDWYERRRRDEYEED
EGGREENGGDEKGRGGRDTRRGGGSGEPELYMVYKGRISRVMDTGCFVSLDEFRGKEGLV
HVSQMATRKIANAKEVVKRDQQVYVKVISVSGSKLSLSMRDVDQHSGKDLLPLKKSSEEE
AFRTNPQDSKDGPVARTGLSGIRIVEEDDMGSSRRPLKRMSSPERWEAKQLIASGVLSVS
EYPTYDDEGDGVMYQEEGAEEELEIEMNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGR
AAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYD
MPEWKKDAYGKTITFGQRSKLSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKT
TQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPD
TVIKYMTDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPELRLIV
TSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDASLITVLQIHLTEPEGD
ILLFLTGQEEIDFACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKV
VVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTG
PGKCYRLYTESAYRNEMSPTSIPEIQRINLGMTTLSMKAMGINDLLSFDFMDPPSPQALI
SAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTG
NIFYRPREKQAQADQKRARFFQPEGDHLTLLAVYESWKNKNFSGPWCFENFVQSRSLRRA
QDVRKQLLTIMDKYKLDVVSAGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYI
HPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQ
ERIEPLYDRYHEPNSWRLSKRRA
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgggttccgatattccacaagatggattgaagaaactggagtatctttcactcgtatcc
aaagtatgcaccgagttagaatctcacaccggcaccagcgacaaagttctcgccgaattc
atcaccgatttaggtcactcttccaactccgtcgaagaattcgacgctaaattgaaagaa
aacggtgctgaaatgcccgattattttgtcagaacgcttctcactataattcatgcgatt
cttcctccaaaacctaagaagcagagagaaaatctgaaagagaatgccaattcgaacacg
aagtttaaggctttggcgatttcagatgataggggtcgtgctgagaagctgagagaagag
attgaaattgaagctagagagaaacagaagccaccaatggaagatgatgatggttataga
gatagggatagaagagatagacatagagatagatatgatagaagggggaatgatagagat
agagataggcgtgaaagagatgataaaagggggagtgatagagatcgtggtgataggcgc
gatagagatgatacaagaggcaatgctagagatagagataggtatgaaaaagatgataaa
agaagagatgatagggatagggatcgatatgaaagagatgataaaagggggaatgataga
gatagggatagggatagggattggtatgagagacgaaggagagatgagtatgaggaggac
gaaggtgggagggaggagaatggtggtgatgagaaagggaggggaggaagagatacgagg
cgtggtggtggttctggtgagccggagttgtatatggtttataaaggaagaatttcaagg
gtgatggatacggggtgttttgtttcgttggatgagtttagagggaaagagggcttggtt
catgtttctcagatggctactaggaagattgcgaatgctaaggaggttgttaagagggat
caacaggtttatgtgaaggtgatatcagtttctgggtcgaagttgagtttgtctatgagg
gatgttgatcagcatagtgggaaggatttacttccgttgaagaagagttcggaggaggag
gcttttaggacgaatccacaagattcaaaggatgggccggtggcgagaactgggctttct
gggattaggattgtggaggaggatgatatgggttcttcgcgtaggccgttgaagagaatg
agctctcctgagagatgggaagcgaaacagttgattgcttcaggggttttgagtgtttca
gagtatccgacttatgatgacgagggagatggagtgatgtaccaagaagaaggtgctgag
gaagagcttgagattgagatgaatgaagatgagcccgcttttttgcaagggcagagcaga
tactcgatggatatgtctcctgttaagatctttaagaatcctgaaggttctctaggccgt
gctgctgcactacagtccgcccttataaaggagagaagggaagtacgagaacagcagcag
cgtaccatgcttgattctattccaaaggatctcaatcgtccttgggaagatcctatgcca
gagtcaggtgaaaggcatcttgctcaggagttgaggggtgttggtttatcggcctatgat
atgcctgaatggaagaaggatgcctatgggaaaaccattacttttgggcaaaggtcgaag
ctttctattcaagaacagaggcagagtttgccaatttacaagttaaaaaaagagttgatt
caggctgtccatgataatcaggtcttggttgtgattggtgaaaccggttcgggtaagact
actcaggtcacacagtatcttgctgaagcgggttacaccaccagaggtaaaattggatgt
actcaaccccgtagggtggctgcaatgtcagttgcaaagagagttgccgaagagtttggg
tgtagattaggagaggaagttggttatgccattcgatttgaggattgcactgggcctgat
actgtaatcaagtacatgaccgatggtatgcttcttagagaaatattggttgatgagaat
ctgtcgcagtattctgttataatgcttgatgaagcccatgagagaactattcatacggat
gttcttttcggactactgaagcagctggtgaagcgtagacccgagttgcgattgattgtc
acatcagctactcttgatgctgaaaagttttcaggatatttctttaactgtaacatcttc
acaattcctggaagaacttttcctgtggagatactttatactaaacagccagaaagcgat
tacttggatgcatctttgatcactgtcctacagattcatttgacagaacctgaaggagac
attcttctcttcttaactggtcaggaggagattgattttgcttgccagtctctctatgag
cgaatgaaaggattaggtaagaatgtcccagagctgatcattttacctgtttatagtgcc
cttcctagtgaaatgcaatctaggatattcgatcctgctcctcccgggaaacggaaagtg
gttgtggctacaaacattgccgaggcatctttgactattgacggaatattttatgttatt
gatccggggtttgctaagcaaaatgtttataacccgaagcaaggtcttgattccttggtg
ataactccgatatcacaagcgtctgccaaacaaagagctggacgtgcagggcgtactgga
cctggaaagtgttatcgcctctataccgagagtgcatatagaaatgaaatgtctcctact
tctattccagagattcaaaggataaatttaggcatgacaactcttagcatgaaagccatg
ggcataaatgatcttctgtcatttgattttatggatccaccatcacctcaagcacttatt
tccgccatggagcagctttacagtcttggagctttggatgaagagggtcttctaaccaaa
ttggggaggaaaatggctgagtttcctttggatccgccactgtccaagatgttgcttgcc
agtgtagatcttgggtgcagtgatgagattctgaccataattgccatgatccagactggc
aatatattttacaggcccagggagaaacaagcccaagcagatcagaaaagggcaaggttt
ttccagccagagggtgaccatcttacgcttcttgctgtttatgaatcctggaaaaataaa
aacttttctggaccttggtgttttgagaactttgttcaatctcgatcgttgagaagagcg
caggatgtaaggaaacaacttctcaccatcatggataagtacaaattggatgttgtgagc
gctggaaaaaacttcacaaagattaggaaggctatcactgcagggttcttttttcatgca
gcaagaaaggacccccaggaaggttacagaacactagttgagaatcagcctgtgtatatc
catccaagttcagctttgttccagaggcaaccagactgggtcatataccacgagcttgta
atgacaacaaaggaatatatgcgcgaagtcacagtcatagaccccaaatggcttgttgaa
ttggctccaagattcttcaaagttgccgatcccacaaagatgagcaaacggaagcgtcaa
gagcgtattgaaccactttatgatagataccacgagccaaactcatggcgtttgagtaaa
cgccgtgcatga

DBGET integrated database retrieval system