KEGG   Medicago truncatula (barrel medic): MTR_1g029840Help
Entry
MTR_1g029840      CDS       T01716                                 

Definition
(RefSeq) NAD-dependent aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00053  Ascorbate and aldarate metabolism
mtr00071  Fatty acid degradation
mtr00280  Valine, leucine and isoleucine degradation
mtr00310  Lysine degradation
mtr00330  Arginine and proline metabolism
mtr00340  Histidine metabolism
mtr00380  Tryptophan metabolism
mtr00410  beta-Alanine metabolism
mtr00561  Glycerolipid metabolism
mtr00620  Pyruvate metabolism
mtr00903  Limonene and pinene degradation
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_1g029840
   00053 Ascorbate and aldarate metabolism
    MTR_1g029840
   00620 Pyruvate metabolism
    MTR_1g029840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MTR_1g029840
   00561 Glycerolipid metabolism
    MTR_1g029840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MTR_1g029840
   00310 Lysine degradation
    MTR_1g029840
   00330 Arginine and proline metabolism
    MTR_1g029840
   00340 Histidine metabolism
    MTR_1g029840
   00380 Tryptophan metabolism
    MTR_1g029840
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTR_1g029840
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MTR_1g029840
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MTR_1g029840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC DHC_N2 HTH_Tnp_IS630
Motif
Other DBs
NCBI-GeneID: 25482459
NCBI-ProteinID: XP_013466476
UniProt: A0A072VGG1
Position
1
AA seq 488 aa AA seqDB search
MASSKLNKKVFDLKEASTTVKDLRITFDSGKTRSYEWKVSQLKALLELTEKHEKEIVEAL
YSDLSKSEAESFIQEVGMLKNSCKTALKELKHWMAPEKVKTSITTFPSSAEIVSEPFGVV
LVISAWNYPFLLSLDPVIGAIAAGNAVVLKPSEIAPATSSLLAKLLGEYMDNSSIRVVEG
AVDETSALLQQKWDKIFYTGNGRVARIVMAAAAKHLTPVVLELGGKSPVVVDSNINLQVA
ARRIIAGKWGCNNGQACISPDYIITTKDYAPKLVDALKTELEQFYGKNPLESKDLSRIVN
SNHFDRLIRLLDDDKVSGKIVHGGEKDKSKLRISPTVLLDVPRDSLIMSEEIFGPLLPII
TVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPFG
GVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLAI
IRALFGKS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctaaacttaacaaaaaagtgtttgatttgaaagaagcttcaacaacagtt
aaagatttgagaataacgtttgattctggtaagactcgaagctatgaatggaaagtttct
cagttgaaggcacttctggaattaactgaaaaacatgagaaagagattgttgaagctctt
tactctgacttatcaaaatctgaagctgaatccttcatccaagaggttggtatgttgaaa
aactcatgtaaaactgcactcaaagaattgaagcattggatggctccggaaaaggtcaaa
acatcaatcacaacttttccttcttcagctgaaatagtatctgaaccatttggagttgtg
ttggtcatctccgcatggaactatccatttttgttatcacttgatccagtcattggagct
attgcagctggtaatgctgtggtcttaaaaccatcagaaattgctccagccacatcatca
ttgctggcaaaactgttaggggaatacatggataactcatctataagagttgttgagggg
gcagttgatgaaacatctgcattactgcaacaaaagtgggacaaaattttctacacaggt
aatggaagagtggcacgcattgtgatggctgctgctgctaagcaccttacaccagttgtg
ctggaacttggaggaaaatcaccagttgttgttgattcaaatatcaacttacaggtggca
gctagaaggataattgctggaaagtggggttgcaacaatggccaagcttgcatttctcca
gattatatcataacaacaaaagattatgctcctaagttggtggatgctctaaagaccgaa
ttagagcagttttatggaaagaatccattggaatcaaaagatttgtcgcgtattgtaaac
tcaaaccacttcgatcgcttgataaggcttttggatgatgataaagtttctggtaagatt
gttcatggaggtgaaaaggataaaagcaaattgaggattagccctactgttctattggat
gtcccgcgtgattctctgataatgagcgaagagatatttggtcctttacttcccatcatt
acggtcgataaactagatgaaagctttgatgtgataaattcagcaccgaagcctcttgct
gcatatatatttacaaacaacaacaagctcaaggagcagtttgttaagactgtttctgct
ggtggtttggtcatcaatgacactactatacaccttgcagttcatactttgccttttgga
ggagtaggtgagagtggagtgggtgcataccatggaaaattctcatttgatgcatttagt
cacaaaaaagcagttctttatcgcagtttttttggtgatgcttctattaggtatccacca
tacaccagtacaaagacgagattgatgaaggctctcatgggtggtggcttccttgctata
attcgtgccttatttggaaagtcctag

DBGET integrated database retrieval system