KEGG   Medicago truncatula (barrel medic): MTR_1g061240
Entry
MTR_1g061240      CDS       T01716                                 

Definition
(GenBank) sterol C-14 reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00100  Steroid biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Module
mtr_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MTR_1g061240
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MTR_1g061240
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: KEH42106
UniProt: A0A072VKE7
Position
1
AA seq 369 aa
MDLDFLIHALIPSWNSVALLAGFFTYLAIVGSILPGKLVPGVVLSDSTRLHYRCNGLLSL
VLLVGLLWISAKMEFVSLTAIADRGLELLSTTFIFSFLVALILYFSGCKSRSKGSSLKPH
ISGDLIHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLLINLSVLAKSIQDGTLSKSMILF
QLFNALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNKVELT
NAAVVANCFVFLIGYMVFRGANKQKHDFKKNPKAPIWGNPPKVIGGKLLASGYWGVARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYRDIWLEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctggattttctcattcacgctctaattccatcatggaactccgttgctttactt
gcgggtttttttacttacttagccattgttggatccattctccctggaaagcttgttcct
ggtgttgttctctctgattctactcgtcttcattatcgatgcaatggtttactttcgctt
gttctgttggttggacttctttggatcagtgccaagatggaatttgtatctcttactgcc
atagcagatagaggacttgagctgctgtctacaacttttatcttcagttttcttgtggcc
ctcatactctatttctccggttgcaagtcacgaagtaaaggttcatcactaaaacctcat
atcagtggagacctgatacatgattggtggtttggaatacaactaaatcctcagttcatg
ggtattgacctcaaatttttctttgttagagctggaatgatggggtggctacttatcaat
ctatcagttcttgctaagagcattcaagatggtactttgagcaagtcaatgattctcttc
cagctattcaatgcactatacatcctggactactttgtacacgaagaatacatgacatcc
acatgggacataattgcagagagactgggcttcatgttggtctttggagatctcgtgtgg
attccttttacttttagcatacagggctggtggctcttgaggaacaaggttgagttaaca
aatgcagctgttgtagctaattgcttcgtcttccttattggatacatggtatttcgagga
gcaaacaagcaaaagcatgatttcaagaaaaacccaaaggctcctatatggggtaatcct
ccaaaagtcattggaggcaagctacttgcgtctggttattggggtgttgctagacactgt
aactacctaggggacttgctgcttgctctctcttttagcttaccttgtggcatcagttca
ccagttccatacttctatccaatttatcttctcattctgttaatctggagagaaagaagg
gatgaagctcgttgtgcagagaagtatagagatatatggttagagtatcgtaaacttgtt
ccatggagaattttgccttatgtttattaa

DBGET integrated database retrieval system