KEGG   Medicago truncatula (barrel medic): MTR_1g068600Help
Entry
MTR_1g068600      CDS       T01716                                 

Definition
(RefSeq) histone H2A 6
  KO
K11252  histone H2B
Organism
mtr  Medicago truncatula (barrel medic)
Brite
Chromosome and associated proteins [BR:mtr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    MTR_1g068600
Exosome [BR:mtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MTR_1g068600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa 4HB_MCP_1 BEX
Motif
Other DBs
NCBI-GeneID: 11431194
NCBI-ProteinID: XP_003590511
UniProt: G7IBM3
Position
1
AA seq 136 aa AA seqDB search
MAPKAEKKPAEKKPAEKSPAEKKPKAEKKISKEGGDKKKKRVKKSVETYKIYIFKVLKQV
HPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQTAVRLVLPGELAK
HAVSEGTKAVTKFTSS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaaggcagagaagaaacccgctgagaagaaacccgcggagaaatcaccagca
gagaaaaagccaaaagccgagaagaagatctcgaaagaaggaggcgataagaagaagaag
cgcgtgaagaagagcgttgaaacctataagatttacatcttcaaggttctcaaacaggtt
catcctgatataggtatttcttccaaagctatggggattatgaacagtttcatcaatgat
atctttgagaaactcgctcaggaagcttctagattggctcgttacaacaagaaaccgacg
attacgtcgagggagattcaaacggctgtgcgtttggttcttcccggtgaattggcgaaa
catgctgtttccgaaggaaccaaggctgttaccaaatttacgagttcttga

DBGET integrated database retrieval system