KEGG   Medicago truncatula (barrel medic): MTR_3g014030Help
Entry
MTR_3g014030      CDS       T01716                                 

Definition
(GenBank) helicase, IBR and zinc finger protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MTR_3g014030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mtr03041]
    MTR_3g014030
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MTR_3g014030
Spliceosome [BR:mtr03041]
 Complex C
  Other components
   Step II factors
    MTR_3g014030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR HA2 OB_NTP_bind DEAD AAA_22 zf-C3HC4 AAA_19 zf-C3HC4_2 zf-RING_UBOX zf-RING_2 ResIII AAA_30 Helicase_RecD ABC_tran AAA_29 RsgA_GTPase KH_1
Motif
Other DBs
NCBI-ProteinID: AES68716
UniProt: G7IYQ4
Position
3
AA seq 1731 aa AA seqDB search
MKKTFPTTNHRTTTRHDSYLRRQPPWRADHHWNPRFQSNHLYYRPRLPYFIVNLRLTHRL
NLRREEIETLIADCKPNPDKFSFQPNESITASLNFNNGTDAISAVVWFWESRLSECRHEL
SPEFIEMNSDNSKHGDELKARLRSVFMSHVKELMEGKEINRWIKEWDRLSKEIKEVNSLL
GKPFPVRVQDENIDRKKMLDGEKNLVEKRLKEFEYAMENILMYLEENNNNNDDDDDVNVI
RFGERFDWEKICNFIVRERRRLEDGLPIYAYRKEILQQIYHQQITVLIGETGSGKSTQLV
QFLADSGVGANESIVCTQPRRIAAKSLAERVREESGGCYEDSSIKCYSSFSSWNKFDSRI
IFMTDHCLLQHYMSDKNFTGISCIIVDEAHERSINTDLLLALIKNLLSKRVEMRLIIMSA
TADAKQLSDYFYGCGIFRVPGRNFPVEVRYVPSEYEGRSHSSVVDPYVSDVVKMATEIHR
TEKEGTILAFLTSQLDVEWACEKFEAPSAVALPLHGKLSSEEQFHIFKNYPGKRKVIFST
NVAETSLTIPGVKYVIDSGLVKDSRFDPSSGMNVLKVCWISQSSAKQRAGRAGRTEPGRC
YRLYSEADYQSMETNQDPEIRRVHLGVAVLKILALGVKNVQDFDFVDAPSTSSIERAIGN
LIQLGAIKLNNDVYELTPEGRRLARMEIEPRLGKLILGCFQYTLGREGIALAAMMANARS
VFCRVGNEGDKQKSDCQKVQFCHCEGDLFTLLSVYMEWEVQPQNWKNKWCWENSINAKSM
RRCQNTFLELESCLESELGLVVPSYWRWDPHNPSIHDKNMKKAILSSLSENVAMYSGRNQ
LGYIVAQTEKHVQLHPSCSLLVFSQRPSWVVFYELRSESNEYLFCVSAVDFQSLYSLKPP
PLFDVSKMEEQKLQTKTLVGFGKHVLKRFCGKGNLLGHVSRIRKACMDERIFVDVNFDEN
HIQLYACSNDMNTASKLVNDVLQYEKKRLHTECMEKCLYHGFGSSSPVAMFGSGAEIKHL
ELEKLPLSVDVFHPNVNAIDEMELLMFFEKNTSGCICDMQKFTGMVKDVEDKAKWGKITF
MTSNAAKRAAELDGEEFCGSPLKIVHSQSAMGGDTTFSFPAVEARISWLRRPIKAVGIIK
CDKNDVDFIIRDFENLIVDGRRYVRCAPSDKYLDNILITGLDKEVPETKILDILRSATSR
RILDFFFKRGDAVENPPCSMIAETILKEISPLMPKKKPHISSCRVQVFPPKPKDYSMNAL
IHFDGRLHLEAAKALEKIDGKVLPGFHSWQKIKTQRLFHSTLIFSPPVYHVIKGQLEKVL
ARFNNLEGLEWKLDITPNGSHRVKITANATKTVAEGRRLLEELWRGKVIVHDNLTPATLQ
PILSKDGSSLTSSIQKATSTYIQFDRRNMKLRIFGSPDKIALAEKKLIQSLLSLHDEKQS
VICLSGRDLPSDFMKQVVKNFGPDLHGLKEKVPGADLRLNTRNRTILCHGNSELKSRVEE
ITFEIARLSNPSSERFDTGPSCPICLCEVEDGYQLEGCGHLFCQSCMVEQCESAIKNQGS
FPIRCAHQGCGNHILLVDFRTLLSNDKLEELFRASLGAFVASSSGTYRFCPSPDCPSIYR
VADPDTASAPFVCGACYSETCTRCHIEYHPYVSCERYRQFKDDPDSSLRDWCKGKEQVKN
CPACGHVIEKVDGCNHIECKCGKHICWVCLEFFTTSGECYSHMDTIHLGVD
NT seq 5196 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacctttcccaccaccaaccaccgcaccaccacccggcatgactcttatctc
cgccgtcaaccaccgtggcgagctgaccatcactggaaccccagattccaatccaaccac
ctctattatcgcccccgcctcccctatttcatcgtcaacctccgcctcacccaccgcctt
aacctccgccgtgaagagatcgagaccctgatcgccgattgcaaaccaaatcctgacaaa
ttttcattccaaccaaacgaaagcatcactgcttctctcaatttcaataacggaacagat
gcgatcagcgccgtcgtttggttctgggaatcacgtttatcagaatgccgtcacgaatta
tcgcccgagttcatcgaaatgaactccgacaattccaaacacggagacgaactcaaagct
cgtctccgaagcgtattcatgagccatgtgaaagaactaatggaaggaaaagaaataaac
cgttggataaaagaatgggatcgtttatcaaaagagattaaagaagttaatagcttatta
ggtaaaccttttccagttagggttcaagatgagaatattgatagaaaaaaaatgcttgat
ggtgaaaaaaatttggttgagaaaagattaaaggaatttgaatatgctatggagaatatt
ttgatgtatttagaagaaaataataataataatgatgatgatgatgatgttaatgtgatt
aggtttggtgaaaggtttgattgggagaagatttgtaattttattgttagggaaaggagg
agacttgaagatggtttgcctatttatgcttataggaaggaaattcttcagcaaatatat
catcaacagataacagtgttgattggagagacaggttctgggaagagtactcaattagtg
cagtttcttgctgattcgggtgttggggccaatgagtcaattgtgtgcactcagcctcgc
aggattgctgcaaaatcattggctgaaagggtccgggaagaaagtggtggatgttatgaa
gacagttcaatcaagtgttattcttcattttcatcttggaacaagttcgattccaggata
atcttcatgacagatcattgtttattgcagcactacatgagtgataaaaattttactggg
atttcgtgtattatagtggacgaggctcatgaaaggagtataaatactgatttactgttg
gcattgataaagaatttactttctaagagggttgaaatgcggcttatcatcatgtctgcc
acagctgatgcaaagcagttatctgattacttctatggttgtggaatttttcgtgtgcca
gggagaaacttccctgtggaggtgagatatgttccatctgaatatgaaggacgatctcat
tcttctgttgtggacccttatgtttccgatgttgttaaaatggcaactgaaattcataga
acagagaaagaaggaactattcttgcctttcttacatcacagttagatgtagaatgggct
tgtgaaaagtttgaagccccctctgcagtagctttgcccttgcatggaaaactttcgtct
gaagagcaatttcatattttcaagaactatcctggaaaaagaaaagtgatattttcaacg
aatgtcgcagagacatcacttacaattcctggtgttaagtatgtgatagattctggattg
gttaaagatagtcgttttgatcctagcagtgggatgaatgtacttaaggtttgctggatc
agccagagttctgctaagcaacgggctggtcgtgctgggaggaccgagcctggtagatgc
tatagactgtactcagaagctgattatcagtctatggaaacaaatcaagatcccgaaatt
cgaagagttcatcttggcgtagcagttttgaagatccttgctttaggggtgaagaatgtc
caggatttcgattttgtggatgctccatccactagctctattgagagggcaatcgggaat
ctaattcaattaggagccattaaactcaacaatgatgtttatgaattaactcctgaaggt
aggcgcttagcaagaatggagattgaacctaggcttggtaaactcattcttggttgtttc
caatataccttgggtagggaaggcattgccctagctgccatgatggccaatgctagaagc
gtattttgcagagttggtaatgaaggtgataagcaaaaatctgattgtcagaaagtgcaa
ttttgccattgcgagggtgacctttttactcttctctctgtgtacatggaatgggaagtc
cagcctcaaaattggaagaataaatggtgttgggaaaacagcatcaatgccaaatctatg
aggagatgccaaaacacatttttggagttagaatcttgcctagagagtgaacttggcctt
gttgttccaagttactggcgctgggaccctcataacccttctattcacgataagaacatg
aaaaaggctatactgtcctcactttctgaaaatgtagccatgtactctggacgcaatcaa
cttggttacatagtagctcaaacggagaaacatgttcaactacatccatcttgttccttg
cttgtattttcccagaggcctagttgggtggttttttatgagcttcgttcagagtctaat
gaatatttgttctgtgtgagtgctgttgactttcaatcattatacagccttaaacctcct
cccttgtttgatgtatccaagatggaagagcagaagttgcaaacaaagacgctggttggt
tttggcaaacatgttctcaagagattttgtgggaaaggaaatttgctcggtcatgtttct
cgtattaggaaagcttgtatggatgaaagaatatttgttgacgtgaattttgacgagaac
cacattcagttgtatgcctgttccaatgatatgaatacagctagtaagctggtgaatgat
gttttacaatatgagaagaagaggttacacactgaatgtatggaaaaatgtttgtatcat
gggtttggttcctcatcacccgtggctatgtttggctctggtgctgagataaagcatttg
gaacttgagaagcttcccttgagtgttgatgtgtttcacccaaacgtaaatgcaattgac
gaaatggagctcctgatgttttttgagaaaaatacttctggttgtatatgtgacatgcaa
aagttcacaggcatggtgaaagatgttgaggataaagcaaaatggggcaagataacattt
atgacctccaatgctgccaaaagagctgctgagctggatggagaagagttttgtggttcg
cccctaaaaatagttcattcacagtcagctatgggaggggatacaacattttcatttcct
gcagttgaagcaagaatttcttggcttcgtaggcctatcaaagcagttggcataatcaaa
tgtgataaaaatgacgtggatttcatcattagagattttgaaaacctcatcgtagatgga
agaaggtatgttcgttgtgctcccagtgataagtatttggacaacattcttataactggg
cttgacaaagaggttcctgagactaaaattttggatatactaagatctgctactagtaga
aggattctagattttttctttaagagaggagacgctgttgaaaatccaccatgcagtatg
attgcagagacaatattaaaagaaatctcccccttaatgcccaaaaaaaaacctcacatt
agttcttgccgtgttcaggtgtttccacctaagccgaaggattattcgatgaatgcttta
attcattttgatggaagattacatttagaagcagcaaaagctttggagaaaattgatgga
aaggtgttgcccggatttcattcttggcagaagataaagacccagcgtttgtttcacagc
accttgatattttctcctccagtgtatcatgtgattaagggacaactggaaaaagtgctg
gcacgtttcaacaatttagaaggtcttgagtggaaactagacataactcctaatggctcc
caccgagtgaaaataacagccaatgccacaaagacggtggcagaaggtaggagacttctg
gaagaactgtggagagggaaagtcattgtccacgacaacctcacccctgccactctacag
cccatattgtccaaagatggttctagtcttacaagctcaatacagaaagcgacttcaact
tacattcaatttgataggcgcaacatgaagttacggatatttggttcgccggacaagatt
gctttggctgagaaaaagttaattcaatctctcttgtccctccatgacgaaaaacagtca
gtaatctgtctgagtggaagggacctaccttctgattttatgaagcaagtggttaagaat
ttcgggccagatcttcatggactaaaagagaaggtacccggggcagatcttaggcttaac
acacgcaaccggacaatcctttgtcatggtaactcggagttgaaatcaagagtggaggaa
ataacttttgagattgcacgtttaagcaatccttcaagcgagagatttgacactggacct
agttgcccaatttgcttgtgtgaggttgaggatggatatcagcttgaaggttgtggtcat
ttgttctgccagtcatgtatggtggagcagtgtgaatctgctataaaaaaccaaggcagt
ttcccaatacgttgtgctcatcagggctgtggaaatcatattttgcttgtagatttcaga
actctcctgtcaaatgataagttggaagaacttttcagggcttctttgggagcttttgta
gcctcaagttcaggaacctataggttttgtccatctcctgactgcccctcaatctataga
gttgcagatcccgacacagctagtgcgccatttgtttgtggggcatgttattcagagact
tgtaccaggtgccatatagagtatcatccgtacgtttcatgtgagagataccgacaattc
aaggatgacccggattcttctctgagggattggtgcaaagggaaagaacaagttaagaat
tgcccggcatgtgggcatgtaattgagaaggtagatgggtgcaatcacattgagtgcaag
tgtggaaaacatatttgctgggtttgcttagagttctttacaaccagcggtgaatgttat
agccatatggatactatacacttgggcgtagattaa

DBGET integrated database retrieval system