KEGG   Medicago truncatula (barrel medic): MTR_3g025250Help
Entry
MTR_3g025250      CDS       T01716                                 

Definition
(GenBank) flavonoid hydroxylase
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00941  Flavonoid biosynthesis
mtr00944  Flavone and flavonol biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    MTR_3g025250
   00944 Flavone and flavonol biosynthesis
    MTR_3g025250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mtr00199]
    MTR_3g025250
Enzymes [BR:mtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     MTR_3g025250
Cytochrome P450 [BR:mtr00199]
 Cytochrome P450, plant type
  CYP75 family
   MTR_3g025250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 LepB_GAP_N EzrA
Motif
Other DBs
NCBI-ProteinID: AES69198
UniProt: G7IWE7
Position
3
AA seq 286 aa AA seqDB search
MLGRRVFNDGNGGCDPKADEFKEMVLELMVLAGVFNISDFIPSLEWLDLQEVQAKMKKLH
KQFDAFLTNIIEEHEASNYKNEKHKDLLLLKEETDDDGNKLTYIEIKNMFAAGKDTSSND
IPNLPYLQTVIKETFRLHPSTPLSLPRIASESCEIFGYHVPKSSTLLVNVWAIARDPKEW
VDPLGFKPERFLLGGEKCDVDVKGNDFEVIPFGAGRRICVGMSLGLRMVQLLTATLAHSF
DWELENGLNAEKKNKDEGYGLTLQRIVPLSVHPKPRLSPHVFSTLI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaagaagagtattcaatgatggcaatggtggttgtgaccctaaagctgatgag
ttcaaggaaatggttcttgaattgatggtgttagctggagtttttaatataagtgatttt
attccttcattagaatggctagaccttcaagaagttcaagctaaaatgaaaaaattacac
aaacaatttgatgcatttttaacaaacattattgaggaacatgaggcatctaattataag
aatgaaaaacataaggatttattgttacttaaagaggaaacggatgatgatggaaacaaa
ctcacttatattgaaatcaaaaacatgtttgcagctgggaaagacacatcatcaaatgac
atacctaacctaccttacctacaaacagtgataaaagaaacatttcgcttgcacccatca
acacctctttccctcccacgaattgcatctgaaagttgtgagatttttgggtaccacgtt
ccaaagagttcaactcttttggttaatgtatgggccattgctcgtgatccaaaagaatgg
gttgatccattaggattcaaacctgaaaggttcttattaggtggtgagaagtgtgatgtt
gatgttaagggaaatgattttgaagttataccttttggtgctggacgtagaatatgtgtt
gggatgagtcttgggcttcgtatggtacagcttctaacagctacactagcccattcattt
gattgggaacttgaaaatgggctcaatgctgaaaaaaagaacaaggatgaaggttatggg
ttgacacttcaacggattgtgccattatcggtgcaccctaagcccagactctcgccacat
gtgttctcaacgttgatctag

DBGET integrated database retrieval system