KEGG   Medicago truncatula (barrel medic): MTR_3g049410Help
Entry
MTR_3g049410      CDS       T01716                                 

Definition
(RefSeq) tryptophan synthase beta type 2
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00260  Glycine, serine and threonine metabolism
mtr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtr01100  Metabolic pathways
mtr01110  Biosynthesis of secondary metabolites
mtr01230  Biosynthesis of amino acids
Module
mtr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTR_3g049410
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTR_3g049410
Enzymes [BR:mtr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTR_3g049410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 11424595
NCBI-ProteinID: XP_003599947
UniProt: G7J1A1
Position
3
AA seq 466 aa AA seqDB search
MASSITNLNSPKLLPISKEQTNPFSHFPSNTLKFASLSSRTFSNVSCSVIRDTSSVLPLQ
DANGSVVLQRPDSFGRFGKFGGKYVPETLMHALTLLEASFHSLAGDEDFQKELAGILKDY
VGRETPLYFAERLTEHYKNANGEGPHIYLKREDLNHTGAHKINNAVAQALLAKKLGKKRI
IAETGAGQHGVATATVCARFGLECIIYMGAQDMERQALNVFRMRLLGAEVRPVHAGTATL
KDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVREFHAVIGKETRKQALEKWGGKPDI
LIACVGGGSNAMGLFHEFVDDSDVRLIGVEAAGFGLNSGKHAATLTKGEVGVLHGAMSYL
LQDDDGQIVEPHSISAGLDYPGVGPEHSFLKDLGRAEYHSITDDEALEAFKRVSRLEGII
PALETSHALAYLEKICPTLPNGTKVVVNFSGRGDKDVQTVTKYLKL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcaatcacaaaccttaactcaccaaaattactacccatttccaaagaacaa
accaacccattttcccattttccatcaaataccttaaagtttgcatctttgtcttcaaga
acattttctaatgtgtcttgttctgttataagagatacttcctctgttcttccattgcag
gatgcaaatgggtcggttgttcttcaacgacccgattcatttgggagatttgggaagttt
ggtgggaaatatgttcctgaaactcttatgcatgctcttactctgcttgaagcttcgttt
cattctcttgctggggatgaagattttcagaaagagctggctgggattctaaaggactat
gttggtcgggagacccctctttattttgcggaaaggttgacggagcattacaagaacgct
aatggtgaaggacctcacatttatctgaagagggaagatcttaaccacaccggggctcat
aagattaacaatgctgttgctcaagctttgcttgccaagaaattaggcaaaaagcgcatt
attgctgaaaccggagctggacagcatggagttgccactgctactgtatgtgctcggttt
ggtttggaatgcattatttatatgggtgcacaggatatggaaaggcaggcactgaatgtt
ttcagaatgcgtcttcttggtgctgaggtgagaccagtccatgctggaactgctacactt
aaggatgctacatcagaggctattagagactgggtgactaatgttgaaacaactcattac
attttgggatctgttgctggaccgcatccatatccaatgatggtaagagagtttcatgct
gtgattggcaaggaaacgagaaagcaagctttggaaaaatggggagggaaaccagatatt
ctgattgcatgtgtcggtggaggttcaaatgccatgggacttttccatgaattcgttgat
gacagtgatgttaggctaattggtgtggaagctgctggctttggcctcaacagtggcaag
catgccgctacgttgacaaagggagaagttggtgttttgcatggagctatgagctatctg
ctgcaggatgatgatggacaaattgttgagcctcactctattagtgcaggcttggactac
cctggtgttggacctgaacatagctttttgaaagacttggggcgtgctgaatatcatagc
atcactgatgatgaagcattggaagcttttaagagagtttcgagacttgaaggcatcatt
ccagctctggagacatcccatgcgttggcatatctagagaaaatatgtccaacccttcct
aatgggacaaaggtcgtggttaacttcagtggccgaggtgataaggatgttcaaactgtt
accaagtacttgaagctttga

DBGET integrated database retrieval system