KEGG   Medicago truncatula (barrel medic): MTR_3g056025Help
Entry
MTR_3g056025      CDS       T01716                                 

Definition
(GenBank) Serine/Threonine-kinase WNK11-like protein
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtr01001]
    MTR_3g056025
   01009 Protein phosphatases and associated proteins [BR:mtr01009]
    MTR_3g056025
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MTR_3g056025
Protein kinases [BR:mtr01001]
 Serine/threonine kinases: Other
  Wnk family
   MTR_3g056025
Protein phosphatases and associated proteins [BR:mtr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MTR_3g056025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal F-112 APH
Motif
Other DBs
NCBI-ProteinID: KEH33979
UniProt: A0A072UVY5
Position
3
AA seq 297 aa AA seqDB search
MPSVQQNPSDKDTETFVETDPTGRYGRYDELLGAGACKKVYKAFDNEEGIEVAWNQVKLR
NFSNDPAMIERLYSEVRLLKNMTNKNIIALYNVWRDKEHNTLNFITEVCTSGNLREYRKK
HKHVSLKALKKWSKQILEGLNYLHVHDPCIIHRDLNCSNVFVNGNTGQVKIGDLGLAAIV
GKNHSAHSILGTPEFMAPELYEENYTEMVDIYSFGMLVLEMVTLEIPYSECDNVAKIYKK
VTSGVRPQSLNKIKDAEVKTFIEKCLAQPRARPSAEELLKDPFFDDVEYDENEDVDC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtgttcaacaaaatccatccgacaaagacacagaaacatttgttgaaactgat
ccaactggaagatatggaagatacgatgaattacttggagctggtgcttgtaaaaaagtc
tataaagcatttgataatgaagaaggaatagaagtagcatggaatcaagttaagctcaga
aatttcagcaatgaccctgcaatgattgaaagactttactctgaagtgagacttcttaaa
aacatgacaaacaaaaacatcattgcactttacaatgtttggagggataaggagcataac
acactgaatttcatcactgaggtttgtacaagtgggaatttgagggagtataggaagaaa
cataaacatgtttctcttaaggctttgaagaagtggtctaaacaaatattggaagggttg
aattatttgcatgttcatgatccttgtatcatccatagagacctcaattgcagtaatgtg
tttgtcaatggaaatactggccaggttaagattggtgacttaggtttggcagcaattgtg
ggaaagaaccactcagcacattcaattctaggcacaccggaatttatggcaccagagcta
tatgaagagaattacacagaaatggtagacatatactcatttggaatgttagtattagag
atggtgacacttgaaattccatatagtgaatgtgacaatgttgcaaagatatacaagaag
gtgacttcaggtgtgagaccacaatccttgaacaagataaaagatgctgaagtcaagact
ttcatcgaaaagtgtcttgctcaaccaagggctagaccttctgctgaggaattgctaaag
gatcctttttttgatgatgtagagtacgatgaaaacgaggatgttgattgctaa

DBGET integrated database retrieval system