KEGG   Medicago truncatula (barrel medic): MTR_3g060390Help
Entry
MTR_3g060390      CDS       T01716                                 

Definition
(RefSeq) MAP kinase-like protein
  KO
K20537  mitogen-activated protein kinase 7/14 [EC:2.7.11.24]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    MTR_3g060390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtr01001]
    MTR_3g060390
Enzymes [BR:mtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MTR_3g060390
Protein kinases [BR:mtr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   MTR_3g060390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 11439599
NCBI-ProteinID: XP_003600364
UniProt: G7IXP3
Position
3
AA seq 334 aa AA seqDB search
MATLVEPEIRNRPRRKHCYTMWETLFDIHTKYRPIKPIGRATYGMVCSSINMDTNEKVAI
KKISNVFDDCGDNVIALKDVMIPDQRTSFKDIYLVYEFMDKDLHRIKSSKPLSNDHCKLY
LVQLLQGLNYLHSANILHRDLKPENLLVNANCDLKMCDFGLARENQVDELLLGCGNYGTS
IDMWSVGSIFAEMLGRKPIFPGKDSLHQMKLIISVLGSQESDLELIVNPKTKAFIKSLPY
TKGTHFSQLHPQADPLAIDLLQKMLVFDPTKRITASEVLQHPYMADLCDDQWRNRPPQVP
LNLHIDENSDNKMIREMMWNEMLHYHPEAAFVNA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttagtggaacccgagatcagaaataggccaaggagaaagcattgttataca
atgtgggaaacattgtttgatattcatacaaagtatcgtccaatcaagcctattggccga
gcaacatatggcatggtgtgctcatccatcaatatggataccaatgagaaagtggcaatc
aagaagattagcaatgtatttgatgattgtggtgacaatgtgattgctctgaaagatgtt
atgataccggaccaaagaacaagttttaaggatatctacttggtctatgaattcatggat
aaagatcttcatcgtattaagtcctctaagccactttccaatgatcattgcaaactctac
ttagttcagttacttcaaggtcttaattatcttcattctgcaaatattcttcaccgggac
ctgaagcctgagaatctgctcgtcaatgcaaattgtgatttgaagatgtgtgatttcggg
cttgctcgggaaaatcaagttgatgagcttctattaggatgtggcaattacggaacctcc
atcgatatgtggtccgttggatccatttttgctgagatgcttggtaggaagccaattttc
cctggaaaggattcgttgcaccaaatgaaactaattataagtgttcttggaagccaagag
tctgatcttgagttaatagttaatccgaaaacaaaggcattcatcaaatcacttccctat
acaaaggggacacacttctctcagctacacccacaagcagatccattagccatagatttg
ttacaaaaaatgcttgtgtttgatccaacaaaaagaattactgcatcagaagtacttcaa
catccatatatggctgatctatgtgatgatcaatggcgtaaccgtcctcctcaagttcca
ttaaatcttcacattgatgaaaattcggataacaaaatgattagagaaatgatgtggaat
gagatgcttcattaccatcctgaagctgcttttgtcaatgcatag

DBGET integrated database retrieval system