KEGG   Medicago truncatula (barrel medic): MTR_3g071580Help
Entry
MTR_3g071580      CDS       T01716                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase PhyIIa protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mtr  Medicago truncatula (barrel medic)
Pathway
mtr00010  Glycolysis / Gluconeogenesis
mtr00562  Inositol phosphate metabolism
mtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTR_3g071580
   00562 Inositol phosphate metabolism
    MTR_3g071580
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     MTR_3g071580
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     MTR_3g071580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 11415895
NCBI-ProteinID: XP_003600971
UniProt: G7J2B7
Position
3
AA seq 493 aa AA seqDB search
MAKTITLVLLIFFLSILHFSNAKDEAFDVRKHLSTVSRYGVVKDITDKNFVPSKIPEGCT
PIHLNLVARHGTRSPTKKRIRELDNLSAQLEVLVRDAKEQKLSLGRVPSWLNGWKSPWHG
RLKGGELIRLGEEELYELGIRIRERFPSLFDEDYHPDIYPIKATQVPRASASAVAFGMGL
FSGNGTLGTGKHRAFAVTSESRASDIMLRFHDCCHNYKDFRKKKEPTVDRLKEPILDEIT
SALVGRHGLNFTRQITSSLWFLCKQEASLLDITDQACSLFSPSEITLLEWTDDLEAFILK
GYGKSLNYRMGMPLLEDVVQSMEQAIKAEEEKHVPGSFEKARLRFAHAETVVPFSCLLGL
FLEESEFDKIQKEKPLELPPKPPQKRKWRGSTVAPFAGNNMLLLYSCPASGKAKSKHFVQ
VLHNEHPIPMPGCHGSDFCPFEVFKEKIVAPHQKHDYDTVCNAKLEPKSSRSMIFQIFQW
LFPLAKGINTTFS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacaatcactctagttctgctaatattcttcctttcaattttacatttctca
aacgctaaagatgaagcttttgatgttcgcaaacatctctccactgtctccaggtacgga
gttgtgaaagacattacagacaagaacttcgttccttctaaaattcctgaaggatgtact
ccaattcatttgaatcttgtggcaaggcatggaactcgttctccgacaaagaaaaggata
agggagttggataatttgtcagctcaactggaagttcttgtaagggatgcaaaagagcag
aaattgtctttgggcagagttccgtcttggttaaatggatggaaatctccttggcatgga
aggcttaagggtggtgagttaattagactaggagaggaagaattatatgaacttggaatc
cggattagagaaaggtttccgagtttgtttgatgaggattatcatccagacatttatcct
ataaaggcaactcaggttccccgagcatcagctagtgctgtggcatttggaatgggtctt
ttcagtggcaatggaactcttggaactgggaaacacagagcttttgctgttacaagtgaa
agccgtgctagtgacatcatgctgagatttcatgattgttgtcataactacaaggatttc
cggaaaaagaaggaacccacagttgatagactcaaggaacctatcttggatgagattaca
tctgcattagttgggcgacatgggctaaattttacaaggcagattacatcatctctctgg
ttcttatgtaaacaggaagcatccttgttggatataactgatcaagcgtgtagtcttttt
agcccatctgagattacattgctggagtggacagatgacttggaggcgtttattctgaag
ggttatggtaaatcactaaattatagaatggggatgccattgcttgaagatgttgttcaa
tccatggagcaagctattaaggctgaagaagaaaagcatgttcctggcagctttgaaaaa
gcaagacttcggtttgctcatgcagaaactgtagtcccattctcatgtctgcttggtttg
tttcttgaagagtctgagtttgacaaaatccagaaggagaaacctttggagctacctcca
aagcctccacagaaacgaaaatggcggggtagcaccgtggctccttttgctggtaacaac
atgctgctcttgtatagttgtcctgcgtcaggcaaagctaaaagcaagcacttcgtgcaa
gtgctgcacaatgaacaccccattccaatgccgggttgtcatggttctgatttctgtcca
tttgaagtattcaaggaaaaaatagtagcacctcatcagaagcatgactatgatacagtt
tgtaatgcaaagctagagccgaagtcctcgcggagcatgatattccaaatatttcagtgg
cttttcccactagcgaaaggcattaacaccacattctcctag

DBGET integrated database retrieval system